SPINK7 Protein, Human (HEK293, His)

SPINK7 Protein, a probable serine protease inhibitor, suggests a role in modulating serine protease activity, crucial in diverse biological processes. Its participation likely regulates proteolytic activities, influencing cellular homeostasis and signaling pathways. Further exploration of specific targeted serine proteases and biological contexts will offer insights into SPINK7's role in cellular processes and potential therapeutic applications. SPINK7 Protein, Human (HEK293, His) is the recombinant human-derived SPINK7 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SPINK7 Protein, Human (HEK293, His) is 66 a.a., with molecular weight of 11 & 13 kDa, respectively.

The SPINK7 protein is identified as a probable serine protease inhibitor. This characterization suggests its potential role in modulating the activity of serine proteases, enzymes involved in various biological processes. As a serine protease inhibitor, SPINK7 likely participates in the regulation of proteolytic activities, with implications for cellular homeostasis and the modulation of signaling pathways. Further investigation into the specific serine proteases targeted by SPINK7 and the biological contexts in which it functions will provide valuable insights into its role in cellular processes and potential therapeutic applications.

Human

HEK293

C-6*His

P58062 (S20-C85)

84651  [NCBI]

SEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITYGNECHLCTESLKSNGRVQFLHDGSC

11&13 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 300 mM NaCl, pH8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.