SPRR2B Protein, Human (P.pastoris, Myc, His)

SPRR2B protein, a cross-linked envelope protein in keratinocytes, starts in the cytosol and undergoes transglutaminase-facilitated cross-linking with membrane proteins. This results in the formation of an insoluble envelope beneath the plasma membrane, emphasizing SPRR2B's vital role in the structural integrity and organization of keratinocytes. SPRR2B Protein, Human (P.pastoris, Myc, His) is the recombinant human-derived SPRR2B protein, expressed by P. pastoris , with N-His, C-Myc labeled tag. The total length of SPRR2B Protein, Human (P.pastoris, Myc, His) is 72 a.a., with molecular weight of ~12.0 kDa.

SPRR2B protein, a cross-linked envelope protein found in keratinocytes, undergoes a distinctive cellular journey. Initially present in the cell cytosol, SPRR2B ultimately undergoes cross-linking with membrane proteins facilitated by transglutaminase. This process culminates in the formation of an insoluble envelope situated beneath the plasma membrane, highlighting SPRR2B's crucial role in the structural integrity and organization of keratinocytes.

Human

P. pastoris

N-His;C-Myc

P35325 (1M-72K)

6701  [NCBI]

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK

Approximately 12.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.