1. Recombinant Proteins
  2. Receptor Proteins
  3. SREC-I/SCARF1 Protein, Human (HEK293, His)

SREC-I/SCARF1 Protein acts as a multifunctional mediator, facilitating Ac-LDL binding and degradation, suggesting a role in lipid metabolism and adhesion. Involved in neurite-like outgrowth, it interacts with SREC2 and AVIL, forming a complex molecular network. The protein's diverse roles underscore its significance in various cellular processes beyond lipid metabolism. SREC-I/SCARF1 Protein, Human (HEK293, His) is the recombinant human-derived SREC-I/SCARF1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SREC-I/SCARF1 Protein, Human (HEK293, His) is 402 a.a., .

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SREC-I/SCARF1 Protein acts as a multifunctional mediator, facilitating Ac-LDL binding and degradation, suggesting a role in lipid metabolism and adhesion. Involved in neurite-like outgrowth, it interacts with SREC2 and AVIL, forming a complex molecular network. The protein's diverse roles underscore its significance in various cellular processes beyond lipid metabolism. SREC-I/SCARF1 Protein, Human (HEK293, His) is the recombinant human-derived SREC-I/SCARF1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SREC-I/SCARF1 Protein, Human (HEK293, His) is 402 a.a., .

Background

SREC-I/SCARF1 Protein serves as a multifunctional mediator in cellular processes, primarily facilitating the binding and degradation of acetylated low-density lipoprotein (Ac-LDL). Beyond its role in lipid metabolism, the protein is implicated in heterophilic interactions, suggesting its function as an adhesion protein. Additionally, SREC-I/SCARF1 is involved in the regulation of neurite-like outgrowth, further emphasizing its diverse roles in cellular dynamics. The protein engages in heterophilic interactions with SREC2 via its extracellular domain, with this interaction being suppressed in the presence of ligands such as Ac-LDL. Notably, SREC-I/SCARF1 also interacts with AVIL, contributing to its intricate network of molecular associations and highlighting its involvement in various cellular processes.

Biological Activity

Measured by its binding ability in a functional ELISA. When Human AcLDL is immobilized at 10 µg/mL (100 µL/well) can bind Human SREC-I/SCARF1. The ED50 for this effect is 48.05 ng/mL.

  • Measured by its binding ability in a functional ELISA. When Human AcLDL is immobilized at 10 µg/mL (100 µL/well) can bind Human SREC-I/SCARF1. The ED50 for this effect is 48.05 ng/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q14162 (S20-T421)

Gene ID

8578

Molecular Construction
N-term
SREC-I (S20-T421)
Accession # Q14162
6*His
C-term
Synonyms
Acetyl LDL receptor; KIAA0149endothelial cells scavenger receptor; MGC47738; SCARF1; scavenger receptor class F, member 1; Scavenger receptor expressed by endothelial cells 1; SREC1; SRECI; SREC-I; SRECscavenger receptor expressed by endothelial cells; SR-F1
AA Sequence

SELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLCRCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQCQADRWGARCEFPCACGPHGRCDPATGVCHCEPGWWSSTCRRPCQCNTAAARCEQATGACVCKPGWWGRRCSFRCNCHGSPCEQDSGRCACRPGWWGPECQQQCECVRGRCSAASGECTCPPGFRGARCELPCPAGSHGVQCAHSCGRCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPGTFGESCEQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTCPTCVQGSCDTVTGDCVCSAGYWGPSCNASCPAGFHGNNCSVPCECPEGLCHPVSGSCQPGSGSRDT

Molecular Weight

Approximately 58-70 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SREC-I/SCARF1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SREC-I/SCARF1 Protein, Human (HEK293, His)
Cat. No.:
HY-P702553
Quantity:
MCE Japan Authorized Agent: