SREC-I/SCARF1 Protein, Human (HEK293, His)

SREC-I/SCARF1 Protein acts as a multifunctional mediator, facilitating Ac-LDL binding and degradation, suggesting a role in lipid metabolism and adhesion. Involved in neurite-like outgrowth, it interacts with SREC2 and AVIL, forming a complex molecular network. The protein's diverse roles underscore its significance in various cellular processes beyond lipid metabolism. SREC-I/SCARF1 Protein, Human (HEK293, His) is the recombinant human-derived SREC-I/SCARF1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SREC-I/SCARF1 Protein, Human (HEK293, His) is 402 a.a., .

SREC-I/SCARF1 Protein serves as a multifunctional mediator in cellular processes, primarily facilitating the binding and degradation of acetylated low-density lipoprotein (Ac-LDL). Beyond its role in lipid metabolism, the protein is implicated in heterophilic interactions, suggesting its function as an adhesion protein. Additionally, SREC-I/SCARF1 is involved in the regulation of neurite-like outgrowth, further emphasizing its diverse roles in cellular dynamics. The protein engages in heterophilic interactions with SREC2 via its extracellular domain, with this interaction being suppressed in the presence of ligands such as Ac-LDL. Notably, SREC-I/SCARF1 also interacts with AVIL, contributing to its intricate network of molecular associations and highlighting its involvement in various cellular processes.

Measured by its binding ability in a functional ELISA. When Human AcLDL is immobilized at 10 µg/mL (100 µL/well) can bind Human SREC-I/SCARF1. The ED₅₀ for this effect is 48.05 ng/mL.

Human

HEK293

C-6*His

Q14162 (S20-T421)

8578

SELDPKGQHVCVASSPSAELQCCAGWRQKDQECTIPICEGPDACQKDEVCVKPGLCRCKPGFFGAHCSSRCPGQYWGPDCRESCPCHPHGQCEPATGACQCQADRWGARCEFPCACGPHGRCDPATGVCHCEPGWWSSTCRRPCQCNTAAARCEQATGACVCKPGWWGRRCSFRCNCHGSPCEQDSGRCACRPGWWGPECQQQCECVRGRCSAASGECTCPPGFRGARCELPCPAGSHGVQCAHSCGRCKHNEPCSPDTGSCESCEPGWNGTQCQQPCLPGTFGESCEQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDPCPTGTFGEDCGSTCPTCVQGSCDTVTGDCVCSAGYWGPSCNASCPAGFHGNNCSVPCECPEGLCHPVSGSCQPGSGSRDT

Approximately 58-70 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<0.1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.