SRPX2 Protein, Mouse (Myc, His-SUMO)

The SRPX2 protein is a ligand for the urokinase plasminogen activator surface receptor and promotes angiogenesis by inducing endothelial cell migration and vascular network formation. It also exerts critical effects on cell migration and adhesion, increases FAK phosphorylation and enhances HGF mitogenic activity. SRPX2 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived SRPX2 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

SRPX2 Protein serves as a ligand for the urokinase plasminogen activator surface receptor, contributing to angiogenesis by inducing endothelial cell migration and the formation of vascular networks. Additionally, it plays a crucial role in cellular migration and adhesion, elevates phosphorylation levels of FAK (focal adhesion kinase), and interacts with and enhances the mitogenic activity of HGF (hepatocyte growth factor). SRPX2 also participates in synapse formation and is essential for ultrasonic vocalizations. It forms homooligomers and interacts with PLAUR, ADAMTS4, and CTSB, further emphasizing its multifaceted roles in cellular processes and signaling pathways.

Mouse

E. coli

N-His;C-Myc;N-SUMO

Q8R054 (W26-E468)

68792  [NCBI]

WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE

Approximately 70.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.