1. Recombinant Proteins
  2. Others
  3. SRPX2 Protein, Mouse (Myc, His-SUMO)

The SRPX2 protein is a ligand for the urokinase plasminogen activator surface receptor and promotes angiogenesis by inducing endothelial cell migration and vascular network formation. It also exerts critical effects on cell migration and adhesion, increases FAK phosphorylation and enhances HGF mitogenic activity. SRPX2 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived SRPX2 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SRPX2 protein is a ligand for the urokinase plasminogen activator surface receptor and promotes angiogenesis by inducing endothelial cell migration and vascular network formation. It also exerts critical effects on cell migration and adhesion, increases FAK phosphorylation and enhances HGF mitogenic activity. SRPX2 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived SRPX2 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

Background

SRPX2 Protein serves as a ligand for the urokinase plasminogen activator surface receptor, contributing to angiogenesis by inducing endothelial cell migration and the formation of vascular networks. Additionally, it plays a crucial role in cellular migration and adhesion, elevates phosphorylation levels of FAK (focal adhesion kinase), and interacts with and enhances the mitogenic activity of HGF (hepatocyte growth factor). SRPX2 also participates in synapse formation and is essential for ultrasonic vocalizations. It forms homooligomers and interacts with PLAUR, ADAMTS4, and CTSB, further emphasizing its multifaceted roles in cellular processes and signaling pathways.

Species

Mouse

Source

E. coli

Tag

N-His;C-Myc;N-SUMO

Accession

Q8R054 (W26-E468)

Gene ID
Molecular Construction
N-term
10*His-SUMO
SRPX2 (W26-E468)
Accession # Q8R054
C-term
Synonyms
Srpx2; Sushi repeat-containing protein SRPX2
AA Sequence

WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE

Molecular Weight

Approximately 70.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SRPX2 Protein, Mouse (Myc, His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SRPX2 Protein, Mouse (Myc, His-SUMO)
Cat. No.:
HY-P71594
Quantity:
MCE Japan Authorized Agent: