SRSF1 Protein, Human (His-SUMO)

SRSF1 protein plays a crucial role in splicing regulation, preventing exon skipping and ensuring splicing accuracy. It interacts with spliceosomal components, forming a bridge between 5'- and 3'-splice site binding elements. SRSF1 stimulates U1 snRNP binding and prefers purine-rich RNA sequences, functioning as a splicing enhancer. It can act as a splicing repressor through isoforms ASF-2 and ASF-3. Additionally, SRSF1 may facilitate mRNA nuclear export and is identified in the spliceosome C complex, participating in ribonucleoprotein complexes with various RNA-binding proteins. Its interactions with multiple proteins highlight its intricate role in splicing and cellular processes. SRSF1 Protein, Human (His-SUMO) is the recombinant human-derived SRSF1 protein, expressed by E. coli, with N-SUMO, N-6*His labeled tag. The total length of SRSF1 Protein, Human (His-SUMO) is 247 a.a., with molecular weight of 43.6 kDa.

SRSF1 protein plays a crucial role in maintaining splicing fidelity by preventing exon skipping and regulating alternative splicing. Its interaction with spliceosomal components, facilitated by RS domains, establishes a bridge between the 5'- and 3'-splice site binding elements, U1 snRNP and U2AF. SRSF1 exhibits preferential binding to purine-rich RNA sequences, acting as a splicing enhancer in vitro through the ASF/SF2 splicing enhancer (ASE). While isoforms ASF-2 and ASF-3 function as splicing repressors, SRSF1 may also serve as an export adapter in mRNA nuclear export via the TAP/NXF1 pathway. Within the spliceosome C complex, it collaborates with other RNA-binding proteins, including DDX5, HNRNPH2, and splicing regulator ARVCF. SRSF1's extensive interactome involves proteins such as SAFB/SAFB1, PSIP1/LEDGF, RSRC1, ZRSR2/U2AF1-RS2, CCDC55, SRPK1, NXF1, CCNL1, CCNL2, CDK11B, and RRP1B, showcasing its multifaceted roles in RNA processing and cellular functions. Additionally, its interaction with TNPO3 facilitates nuclear import when phosphorylated in the RS domain, and it interacts with ILDR1 and ILDR2.

Human

E. coli

N-SUMO;N-6*His

Q07955 (S2-T248)

6426  [NCBI]

SGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT

43.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.