ST8SIA1 Protein, Human (HEK293, His)

The ST8SIA1 protein links sialic acid to ganglioside GM3 via an α 2,8-bond to form ganglioside GD3. ST8SIA1 Protein, Human (HEK293, His) is the recombinant human-derived ST8SIA1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ST8SIA1 Protein, Human (HEK293, His) is 308 a.a., with molecular weight of ~48.0 kDa.

ST8SIA1 protein catalyzes the addition of sialic acid in alpha 2,8-linkage to the sialic acid moiety of ganglioside GM3, leading to the formation of ganglioside GD3. Gangliosides represent a subfamily of complex glycosphingolipids characterized by the presence of one or more sialic acid residues. This enzymatic activity extends to the potential addition of a second alpha-2,8-sialic acid to GD3, resulting in the formation of GT3. ST8SIA1 can also utilize GM1b, GD1a, and GT1b as acceptor substrates to synthesize GD1c, GT1a, and GQ1b, respectively. Notably, in breast cancer cells, ST8SIA1 exhibits the ability to synthesize unconventional tetra- and pentasialylated lactosylceramide derivatives identified as GQ3 (II3Neu5Ac4-Gg2Cer) and GP3 (II3Neu5Ac5-Gg2Cer). This diverse enzymatic repertoire underscores ST8SIA1's role in ganglioside biosynthesis, contributing to the structural complexity and functional diversity of these glycosphingolipids in cellular processes and disease contexts.

Human

HEK293

C-6*His

Q92185 (Y49-S356)

6489  [NCBI]

YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS

Approximately 48.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.