Staphylokinase Protein, S. aureus

Staphylokinase Protein efficiently converts plasminogen into active plasmin, a key enzyme in fibrinolysis. It forms a 1:1 complex with plasmin, activating additional plasminogen molecules and amplifying the fibrinolytic cascade. Staphylokinase Protein, S. aureus is the recombinant Staphylococcus aureus-derived Staphylokinase protein, expressed by E. coli , with tag free. The total length of Staphylokinase Protein, S. aureus is 136 a.a., with molecular weight of ~15.6 kDa.

Staphylokinase Protein is a potent plasminogen activator that efficiently converts plasminogen into plasmin, an active enzyme involved in fibrinolysis. It forms a 1:1 complex with plasmin, and this complex further activates additional plasminogen molecules, amplifying the fibrinolytic cascade.

The specific activity determined by fibrining lysis in agarose plate is >5.0 × 10⁴ IU/mg.

Staphylococcus aureus

E. coli

Tag Free

P68802 (S28-K163)

58067813

SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK

Approximately 15.6 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg; determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.