STAT3 Protein, Human (His-Sumo)

STAT3 is a signal transducer and transcriptional activator that coordinates diverse cellular processes in response to growth factors and cytokines such as interleukin-6 and KITLG/SCF. Upon activation, STAT3 recruits coactivators to target gene promoters, thereby affecting proliferation, differentiation, and immune responses. STAT3 Protein, Human (His-Sumo) is the recombinant human-derived STAT3 protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of STAT3 Protein, Human (His-Sumo) is 191 a.a., with molecular weight of ~38.3 kDa.

STAT3, a signal transducer and transcription activator, orchestrates cellular responses to various growth factors, interleukins, and cytokines. Upon activation, STAT3 recruits coactivators to the promoter region of target genes, thereby mediating diverse cellular processes such as proliferation, differentiation, and immune response regulation. It responds to signaling from interleukin-6, KITLG/SCF, and other growth factors, facilitating a cascade of downstream events. Additionally, STAT3 plays a role in cell cycle regulation, inflammatory response modulation, and energy homeostasis. Its functions extend to influencing apoptosis, melanocortin production, and insulin secretion. The protein's activation involves homodimerization or heterodimerization with related family members. STAT3 interacts with an array of molecules, including IL31RA, NCOA1, PELP1, SIPAR, SOCS7, STATIP1, and others, contributing to its intricate involvement in cellular signaling pathways.

Human

E. coli

N-6*His;N-SUMO

P40763-1 (E50-L240)

6774  [NCBI]

ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL

Approximately 38.3 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.