STAT5B Protein, Human (His)

The STAT5B protein plays dual roles in signal transduction and transcriptional activation in response to KITLG/SCF and growth factors. STAT5B Protein, Human (His) is the recombinant human-derived STAT5B protein, expressed by E. coli , with C-6*His labeled tag. The total length of STAT5B Protein, Human (His) is 321 a.a., with molecular weight of ~38.0 kDa.

STAT5B, a multifunctional protein, orchestrates signal transduction and transcriptional activation, playing a pivotal role in cellular responses to various stimuli, including the cytokine KITLG/SCF and other growth factors. Functioning as a transcription factor, STAT5B binds to the GAS element and facilitates PRL-induced transcription, positively regulating hematopoietic/erythroid differentiation. Upon activation, it forms homodimers and heterodimers with related family members, contributing to its diverse functional roles. Additionally, STAT5B engages in protein-protein interactions, including binding to NR3C1 and forming complexes with NCOA1, NMI, and SOCS7. Notably, its interaction with INSR, facilitated by the SH2 domain, highlights its involvement in insulin signaling. Moreover, the interaction with CPEB3 serves to inhibit STAT5B-mediated transcriptional activation, adding a layer of regulatory complexity to its diverse cellular functions.

Human

E. coli

C-6*His

P51692 (M1-T321)

6777  [NCBI]

MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATIT

Approximately 38.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 10% Trehalose, 1 mM DTT, 0.05% Tween 80, pH 8.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.