STAT6 Protein, Human (His)

STAT6 is a multifunctional protein that performs dual functions of signal transduction and transcriptional activation. It plays a crucial role in mediating IL4/interleukin-4 and IL3/interleukin-3 induced signaling cascades. STAT6 Protein, Human (His) is the recombinant human-derived STAT6 protein, expressed by E. coli , with C-6*His labeled tag. The total length of STAT6 Protein, Human (His) is 211 a.a..

STAT6 (Signal Transducer and Activator of Transcription 6) is a multifunctional protein that plays a dual role in signal transduction and transcriptional activation. It is particularly involved in mediating signaling pathways triggered by interleukin-4 (IL-4) and interleukin-3 (IL-3). STAT6 can form homodimers or heterodimers with related family members, facilitating its engagement in various cellular processes. Additionally, STAT6 interacts with the nuclear receptor coactivator NCOA1 through its C-terminal LXXLL motif, suggesting a potential role in modulating gene expression. This interaction further underscores STAT6's involvement in transcriptional regulation, highlighting its versatility in coordinating signaling events and transcriptional responses in cellular pathways.

Human

E. coli

C-6*His

P42226 (S627-S837)

6778  [NCBI]

SHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMS

Approximately 30.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.