Stratifin Protein, Human

Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human is the recombinant mouse-derived Stratifin protein, expressed by E. coli , with tag free.

Stratifin, also known as 14-3-3 sigma, encoded by the SFN gene, is a multifunctional protein belonging to the 14-3-3 family. It serves as an adapter protein, engaging in diverse cellular processes by binding to numerous partners through the recognition of phosphoserine or phosphothreonine motifs. Its pivotal roles include regulation of epithelial cell growth and protein synthesis when bound to keratin 17 (KRT17), as well as potential involvement in MDM2 autoubiquitination and degradation, leading to the activation of the tumor suppressor p53. Existing as a homodimer and participating in various protein complexes, stratifin interacts with a wide array of proteins, such as GAB2, SAMSN1, SRPK2, COPS6, COP1, DAPK2, PI4KB, SLITRK1, and LRRK2, showcasing its versatility in orchestrating crucial cellular processes and signaling pathways.

Human

E. coli

Tag Free

P31947-1 (M1-S248)

2810  [NCBI]

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

Approximately 30.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 250 mM NaCl, 1 mM EDTA, 1 mM DTT, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.