Stromelysin-1/MMP-3 Protein, Human (HEK293, His)

The Stromelysin-1/MMP-3 protein is a multifunctional metalloprotease that degrades a variety of extracellular matrix components and activates molecules such as growth factors, plasminogen, and MMP9. It is released into the ECM and is activated through the plasmin cascade. Stromelysin-1/MMP-3 Protein, Human (HEK293, His) is the recombinant human-derived Stromelysin-1/MMP-3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Stromelysin-1/MMP-3 Protein, Human (HEK293, His) is 460 a.a., with molecular weight of ~60 kDa.

Stromelysin-1/MMP-3, a metalloproteinase, exhibits a broad substrate specificity, capable of degrading various components of the extracellular matrix (ECM) such as fibronectin, laminin, gelatins (type I, III, IV, and V), collagens (III, IV, X, and IX), and cartilage proteoglycans. This enzyme plays a pivotal role in activating different molecules, including growth factors, plasminogen, or other matrix metalloproteinases like MMP9. Upon release into the ECM, the inactive pro-enzyme undergoes activation through the plasmin cascade signaling pathway. Stromelysin-1/MMP-3 also functions intracellularly, as observed in dopaminergic neurons where it becomes activated by the serine protease HTRA2 during stress, contributing to dopamine neuronal degeneration by mediating microglial activation and alpha-synuclein/SNCA cleavage. Additionally, this metalloproteinase plays a role in immune response and exhibits antiviral activity against various viruses, including vesicular stomatitis virus, influenza A virus (H1N1), and human herpes virus 1. Mechanistically, it translocates from the cytoplasm into the cell nucleus upon virus infection to modulate NF-kappa-B activities.

Measured by its ability to cleave the fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The specific activity is 3134.18 pmol/min/µg, as measured under the described conditions.

Human

HEK293

C-6*His

P08254 (Y18-C477)

4314  [NCBI]

YPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

Approximately 60 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 0.05% Brij35, 10% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.