SULT1A1 Protein, Human (His)

SULT1A1 Protein, Human (His) is the recombinant human-derived SULT1A1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SULT1A1 Protein, Human (His) is 295 a.a., with molecular weight of ~32.0 kDa.

Measured by its ability to transfer sulfate from PAPS to 1-Napthol. The specific activity is 56.4 pmol/min/μg.

Human

E. coli

N-6*His

AAH00923.1 (M1-L295)

6817  [NCBI]

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Approximately 32-34 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM PB, 10% Trehalose, 50 mM Nacl, 0.05% Tween 80, pH 7.8 or 50 mM PB, 50 mM NaCl, pH 7.8, 10% Glycerol, 10% trehalose and 0.05% Tween80.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.