1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. SULT1A1 Protein, Human (His)

SULT1A1 Protein, Human (His) is the recombinant human-derived SULT1A1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SULT1A1 Protein, Human (His) is 295 a.a., with molecular weight of ~32.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SULT1A1 Protein, Human (His) is the recombinant human-derived SULT1A1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SULT1A1 Protein, Human (His) is 295 a.a., with molecular weight of ~32.0 kDa.

Biological Activity

Measured by its ability to transfer sulfate from PAPS to 1-Napthol. The specific activity is 56.4 pmol/min/μg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAH00923.1 (M1-L295)

Gene ID
Molecular Construction
N-term
6*His
SULT1A1 (M1-L295)
Accession # AAH00923.1
C-term
Synonyms
Sulfotransferase 1A1; ST1A1; Aryl sulfotransferase 1; HAST1/HAST2; Phenol Sulfotransferase 1; Phenol-Sulfating Phenol Sulfotransferase 1; P-PST 1; ST1A3; Thermostable Phenol Sulfotransferase; Ts-PST; SULT1A1; STP; STP1; OK/SW-cl.88
AA Sequence

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Molecular Weight

Approximately 32-34 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 10% Trehalose, 50 mM Nacl, 0.05% Tween 80, pH 7.8 or 50 mM PB, 50 mM NaCl, pH 7.8, 10% Glycerol, 10% trehalose and 0.05% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SULT1A1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SULT1A1 Protein, Human (His)
Cat. No.:
HY-P70969
Quantity:
MCE Japan Authorized Agent: