1. Recombinant Proteins
  2. Others
  3. SUMO1 Protein, Human (His)

SUMO1 Protein, Human (His)

Cat. No.: HY-P70997
SDS COA Handling Instructions

SUMO1 Protein is a member of the SUMO (small ubiquitin-like modifier) protein family. SUMO1 binds to target proteins as part of a post-translational modification system. It is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. SUMO1 also regulates the function of several proteins via non-covalent interactions. SUMO1 Protein, Human (His) is the recombinant human-derived SUMO1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SUMO1 Protein, Human (His) is 101 a.a., with molecular weight of 17-19 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SUMO1 Protein is a member of the SUMO (small ubiquitin-like modifier) protein family. SUMO1 binds to target proteins as part of a post-translational modification system. It is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. SUMO1 also regulates the function of several proteins via non-covalent interactions. SUMO1 Protein, Human (His) is the recombinant human-derived SUMO1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SUMO1 Protein, Human (His) is 101 a.a., with molecular weight of 17-19 kDa.

Background

Small ubiquitin-related modifier 1 (SUMO1) is an ubiquitin-like protein that is a member of the SUMO protein family. SUMO1 binds to target proteins as part of a post-translational modification system. It is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. And it is not active until the last four amino acids of the carboxy-terminus have been cleaved off. SUMO1 also regulates the function of several proteins via non-covalent interactions involving the hydrophobic patch in the target protein identified as SUMO Binding or Interacting Motif (SBM/SIM). SUMO1 hinders α-Synuclein fibrillation by inducing structural compaction. SUMO1 acts as a signal for proteasomal degradation of modified proteins, and regulates a network of genes involved in palate development. It is also critical for post-infarction heart repair and that deletion of the SUMO1 gene aggravated myocardial injury after myocardial infarction (MI)[1][2][3][4].

Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAH66306 (M1-V101)

Gene ID
Molecular Construction
N-term
6*His
SUMO1 (M1-V101)
Accession # AAH66306
C-term
Synonyms
Small Ubiquitin-Related Modifier 1; SUMO-1; GAP-Modifying Protein 1; GMP1; SMT3 Homolog 3; Sentrin; Ubiquitin-Homology Domain Protein PIC1; Ubiquitin-Like Protein SMT3C; Smt3C; Ubiquitin-Like Protein UBL1; SUMO1; SMT3C; SMT3H3; UBL1
AA Sequence

MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNNTPKELGMEEEDVIEVYQEQTGGHSTV

Molecular Weight

17-19 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, pH 8.5 .

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SUMO1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SUMO1 Protein, Human (His)
Cat. No.:
HY-P70997
Quantity:
MCE Japan Authorized Agent: