SUMO1 Protein, Human (His)

SUMO1 Protein is a member of the SUMO (small ubiquitin-like modifier) protein family. SUMO1 binds to target proteins as part of a post-translational modification system. It is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. SUMO1 also regulates the function of several proteins via non-covalent interactions. SUMO1 Protein, Human (His) is the recombinant human-derived SUMO1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SUMO1 Protein, Human (His) is 101 a.a., with molecular weight of 17-19 kDa.

Small ubiquitin-related modifier 1 (SUMO1) is an ubiquitin-like protein that is a member of the SUMO protein family. SUMO1 binds to target proteins as part of a post-translational modification system. It is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. And it is not active until the last four amino acids of the carboxy-terminus have been cleaved off. SUMO1 also regulates the function of several proteins via non-covalent interactions involving the hydrophobic patch in the target protein identified as SUMO Binding or Interacting Motif (SBM/SIM). SUMO1 hinders α-Synuclein fibrillation by inducing structural compaction. SUMO1 acts as a signal for proteasomal degradation of modified proteins, and regulates a network of genes involved in palate development. It is also critical for post-infarction heart repair and that deletion of the SUMO1 gene aggravated myocardial injury after myocardial infarction (MI)^[1][2][3][4].

Human

E. coli

N-6*His

AAH66306 (M1-V101)

7341  [NCBI]

MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNNTPKELGMEEEDVIEVYQEQTGGHSTV

17-19 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, pH 8.5 .

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.