1. Recombinant Proteins
  2. Others
  3. SUSD4 Protein, Human (HEK293, Fc)

SUSD4 protein acts as a complement inhibitor by disrupting classical C3 convertase formation. Isoform 3 specifically inhibits the classical complement pathway, and membrane-bound isoform 1 inhibits C3b deposition through classical and alternative pathways, showcasing SUSD4's regulatory role in complement activation and potential significance in immune response modulation. SUSD4 Protein, Human (HEK293, Fc) is the recombinant human-derived SUSD4 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of SUSD4 Protein, Human (HEK293, Fc) is 249 a.a., with molecular weight of ~67 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SUSD4 protein acts as a complement inhibitor by disrupting classical C3 convertase formation. Isoform 3 specifically inhibits the classical complement pathway, and membrane-bound isoform 1 inhibits C3b deposition through classical and alternative pathways, showcasing SUSD4's regulatory role in complement activation and potential significance in immune response modulation. SUSD4 Protein, Human (HEK293, Fc) is the recombinant human-derived SUSD4 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of SUSD4 Protein, Human (HEK293, Fc) is 249 a.a., with molecular weight of ~67 kDa.

Background

SUSD4 protein functions as a complement inhibitor by disrupting the formation of the classical C3 convertase. The isoform 3 of SUSD4 specifically inhibits the classical complement pathway, while the membrane-bound isoform 1 plays a role in inhibiting the deposition of C3b through both the classical and alternative complement pathways. These activities underscore the regulatory role of SUSD4 in modulating complement activation and highlight its potential significance in immune response modulation.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

Q5VX71-3 (F42-F290)

Gene ID
Molecular Construction
N-term
SUSD4 (F42-F290)
Accession # Q5VX71-3
mFc
C-term
Synonyms
Sushi domain-containing protein 4
AA Sequence

FGPAQLTGGFDDLQVCADPGIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTCSSTSTTTSLF

Molecular Weight

Approximately 60-75 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SUSD4 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SUSD4 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77217
Quantity:
MCE Japan Authorized Agent: