SUSD4 Protein, Human (HEK293, Fc)

SUSD4 protein acts as a complement inhibitor by disrupting classical C3 convertase formation. Isoform 3 specifically inhibits the classical complement pathway, and membrane-bound isoform 1 inhibits C3b deposition through classical and alternative pathways, showcasing SUSD4's regulatory role in complement activation and potential significance in immune response modulation. SUSD4 Protein, Human (HEK293, Fc) is the recombinant human-derived SUSD4 protein, expressed by HEK293, with C-mFc labeled tag. The total length of SUSD4 Protein, Human (HEK293, Fc) is 249 a.a., with molecular weight of ~67 kDa.

SUSD4 protein functions as a complement inhibitor by disrupting the formation of the classical C3 convertase. The isoform 3 of SUSD4 specifically inhibits the classical complement pathway, while the membrane-bound isoform 1 plays a role in inhibiting the deposition of C3b through both the classical and alternative complement pathways. These activities underscore the regulatory role of SUSD4 in modulating complement activation and highlight its potential significance in immune response modulation.

Human

HEK293

C-mFc

Q5VX71-3 (F42-F290)

55061  [NCBI]

FGPAQLTGGFDDLQVCADPGIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTCSSTSTTTSLF

Approximately 60-75 kDa

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.