1. Recombinant Proteins
  2. Others
  3. Syntaxin-8 Protein, Human

Syntaxin-8 is a vesicular transport protein that promotes retrograde transport within the early secretory pathway. It is essential for homotypic fusion of late endosomes, forming a SNARE complex with STX7, VTI1B, and VAMP8. Syntaxin-8 Protein, Human is the recombinant human-derived Syntaxin-8 protein, expressed by E. coli , with tag free. The total length of Syntaxin-8 Protein, Human is 215 a.a., with molecular weight of ~28.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Syntaxin-8 is a vesicular transport protein that promotes retrograde transport within the early secretory pathway. It is essential for homotypic fusion of late endosomes, forming a SNARE complex with STX7, VTI1B, and VAMP8. Syntaxin-8 Protein, Human is the recombinant human-derived Syntaxin-8 protein, expressed by E. coli , with tag free. The total length of Syntaxin-8 Protein, Human is 215 a.a., with molecular weight of ~28.0 kDa.

Background

Syntaxin-8, a vesicle trafficking protein, operates within the early secretory pathway, potentially facilitating retrograde transport from cis-Golgi membranes to the endoplasmic reticulum (ER). It plays a crucial role in homotypic fusion of late endosomes by forming a SNARE complex with STX7, VTI1B, and VAMP8. As a component of the SNARE core complex containing STX7, VAMP8, and VTI1B, Syntaxin-8 engages in intricate molecular interactions. It interacts with VAMP8, contributing to the coordination of vesicle fusion events. Additionally, Syntaxin-8 interacts with HECTD3 and TPC1, further highlighting its involvement in diverse cellular processes and emphasizing its significance in vesicle trafficking and membrane fusion events.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q9UNK0 (M1-G215)

Gene ID
Molecular Construction
N-term
Syntaxin-8 (M1-G215)
Accession # Q9UNK0
C-term
Synonyms
Syntaxin-8; STX8
AA Sequence

MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG

Molecular Weight

Approximately 28.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Syntaxin-8 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Syntaxin-8 Protein, Human
Cat. No.:
HY-P71348
Quantity:
MCE Japan Authorized Agent: