1. Recombinant Proteins
  2. Others
  3. T-PA Protein, Mouse (HEK293, Fc)

The T-PA protein converts the inactive plasminogen to active plasmin by hydrolyzing a single Arg-Val bond.This conversion regulates plasmin-mediated proteolysis and is involved in tissue remodeling, degradation, and cell migration.T-PA also contributes to the prevention of polyspermy during oocyte activation by participating in the cortical granule reaction.T-PA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived T-PA protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The T-PA protein converts the inactive plasminogen to active plasmin by hydrolyzing a single Arg-Val bond.This conversion regulates plasmin-mediated proteolysis and is involved in tissue remodeling, degradation, and cell migration.T-PA also contributes to the prevention of polyspermy during oocyte activation by participating in the cortical granule reaction.T-PA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived T-PA protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The T-PA protein functions by converting the inactive zymogen plasminogen into active plasmin through the hydrolysis of a single Arg-Val bond. This conversion is crucial for regulating plasmin-mediated proteolysis, which is involved in tissue remodeling, degradation, cell migration, and various physiological and pathological processes. Additionally, during oocyte activation, T-PA plays a role in the cortical granule reaction within the zona reaction, contributing to the prevention of polyspermy.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

P11214 (I309-Q559)

Gene ID
Molecular Construction
N-term
hFc
T-PA (I309-Q559)
Accession # P11214
C-term
Synonyms
Tissue-type plasminogen activator; t-PA; Plat
AA Sequence

IKGGLYTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVLSAAHCFLERFPPNHLKVVLGRTYRVVPGEEEQTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQESSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLFNKTVTNNMLCAGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGLGCGQKDVPGVYTKVTNYLDWIHDNMKQ

Molecular Weight

55-60 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS, pH 7.4. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

T-PA Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
T-PA Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P73583
Quantity:
MCE Japan Authorized Agent: