1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Ligases (EC 6)
  4. T4 gp32 Protein, T4 phage (His)

T4 gp32 is a single-stranded DNA-binding protein actively involved in various stages of viral DNA processes, including replication, recombination, and repair. During replication, it covers the lagging strand of single-stranded DNA, supporting the replication fork. T4 gp32 Protein, T4 phage (His) is the recombinant T4 gp32 protein, expressed by E. coli , with N-6*His labeled tag. T4 gp32 Protein, T4 phage (His), has molecular weight of ~33.5 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

T4 gp32 is a single-stranded DNA-binding protein actively involved in various stages of viral DNA processes, including replication, recombination, and repair. During replication, it covers the lagging strand of single-stranded DNA, supporting the replication fork. T4 gp32 Protein, T4 phage (His) is the recombinant T4 gp32 protein, expressed by E. coli , with N-6*His labeled tag. T4 gp32 Protein, T4 phage (His), has molecular weight of ~33.5 kDa.

Background

T4 gp32, a single-stranded DNA-binding protein, actively participates in various stages of viral DNA processes, including replication, recombination, and repair. During replication, it coats the lagging-strand single-stranded DNA, providing essential support to the advancing replication fork. This versatile protein stimulates the activities of the viral DNA polymerase and the DnaB-like SF4 replicative helicase, likely through its interaction with the helicase assembly factor. T4 gp32, in collaboration with the replicative helicase and the helicase assembly factor, facilitates the pairing of homologous DNA molecules, mediates homologous DNA strand exchange, and promotes the formation of joint molecules. Acting as an mRNA-specific autogenous translational repressor, T4 gp32 exhibits a dynamic oligomeric state, forming homodimers in the absence of DNA and monomers upon DNA binding. It is an integral part of the replicase complex, contributing to the coordination of DNA replication machinery, including the DNA polymerase, polymerase clamp, clamp loader complex, primase, DnaB-like SF4 replicative helicase, and the helicase assembly factor. Additionally, T4 gp32 interacts with viral SF1 dDA helicase and viral SF2 UvsW repair helicase, highlighting its central role in orchestrating viral DNA processes.

Species

Others

Source

E. coli

Tag

N-6*His

Accession
Gene ID

1258602  [NCBI]

Molecular Construction
N-term
6*His
T4 gp32
Accession # P03695
C-term
Synonyms
T4 gp32, T4 phage (His)
AA Sequence

MFKRKSTAELAAQMAKLNGNKGFSSEDKGEWKLKLDNAGNGQAVIRFLPSKNDEQAPFAILVNHGFKKNGKWYIETCSSTHGDYDSCPVCQYISKNDLYNTDNKEYSLVKRKTSYWANILVVKDPAAPENEGKVFKYRFGKKIWDKINAMIAVDVEMGETPVDVTCPWEGANFVLKVKQVSGFSNYDESKFLNQSAIPNIDDESFQKELFEQMVDLSEMTSKDKFKSFEELNTKFGQVMGTAVMGGAAATAAKKADKVADDLDAFNVDDFNTKTEDDFMSSSSGSSSSADDTDLDDLLNDL

Molecular Weight

Approximately 33.5 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Documentation

T4 gp32 Protein, T4 phage (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
T4 gp32 Protein, T4 phage (His)
Cat. No.:
HY-P78939
Quantity:
MCE Japan Authorized Agent: