TAFA4 Protein, Human (His)

TAFA4 protein, a modulator of injury-induced and chemical pain hypersensitivity, influences pain responses. It serves as a ligand for FPR1, chemoattracting macrophages, enhancing phagocytosis, and elevating reactive oxygen species (ROS) release. TAFA4's multifaceted role indicates involvement in immune responses and cellular processes related to inflammation and injury. TAFA4 Protein, Human (His) is the recombinant human-derived TAFA4 protein, expressed by E. coli , with N-6*His labeled tag. The total length of TAFA4 Protein, Human (His) is 106 a.a., with molecular weight of ~16.0 kDa.

TAFA4 protein serves as a modulator of injury-induced and chemical pain hypersensitivity, potentially influencing pain responses. Acting as a ligand for FPR1, TAFA4 demonstrates the capacity to chemoattract macrophages, enhance phagocytosis, and elevate reactive oxygen species (ROS) release. This multifaceted role suggests its involvement in immune responses and cellular processes associated with inflammation and injury.

Human

E. coli

N-6*His

Q96LR4 (S35-R140)

151647  [NCBI]

SSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVEASIVIQKWWCHMNPCLEGEDCKVLPDYSGWSCSSGNKVKTTKVTR

Approximately 16.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM HAc-NaAc, 150 mM NaCl, pH 4.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.