1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL17
  6. TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi)

TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi)

Cat. No.: HY-P702846
Handling Instructions Technical Support

The TARC/CCL17 protein attracts T lymphocytes, particularly Th2 cells, and is involved in inflammation and immunity. It binds to CCR4 on T cells and contributes to GM-CSF/CSF2-induced pain and inflammation. In the brain, it maintains hippocampal microglia morphology and aids in adapting to neuroinflammation. Additionally, it plays a role in wound healing by promoting fibroblast migration. TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi) is the recombinant dog-derived TARC/CCL17 protein, expressed by E. coli , with N-MBP, C-6*His-Avi labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TARC/CCL17 protein attracts T lymphocytes, particularly Th2 cells, and is involved in inflammation and immunity. It binds to CCR4 on T cells and contributes to GM-CSF/CSF2-induced pain and inflammation. In the brain, it maintains hippocampal microglia morphology and aids in adapting to neuroinflammation. Additionally, it plays a role in wound healing by promoting fibroblast migration. TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi) is the recombinant dog-derived TARC/CCL17 protein, expressed by E. coli , with N-MBP, C-6*His-Avi labeled tag.

Background

TARC/CCL17 protein serves as a chemokine with specific chemotactic activity for T lymphocytes, particularly Th2 cells, while exhibiting no such attraction for monocytes or granulocytes. Its involvement extends to various inflammatory and immunological processes, facilitated by the binding to CCR4 on the surface of T cells. Additionally, TARC/CCL17 contributes to GM-CSF/CSF2-driven pain and inflammation. In the brain, this chemokine is crucial for maintaining the characteristic, highly branched morphology of hippocampal microglia under homeostatic conditions and may play a pivotal role in adapting microglial morphology and synaptic plasticity during acute lipopolysaccharide (LPS)-induced neuroinflammation. Moreover, TARC/CCL17 plays a significant role in wound healing, primarily by inducing fibroblast migration into the wound.

Species

Dog

Source

E. coli

Tag

C-6*His;C-Avi;N-MBP

Accession

Q95N01 (A24-S99)

Gene ID

403586

Molecular Construction
N-term
MBP
CCL17 (A24-S99)
Accession # Q95N01
6*His-Avi
C-term
Synonyms
rHuTARC/CCL17; C-C motif chemokine 17; SCYA17
AA Sequence

ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES

Molecular Weight

60 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TARC/CCL17 Protein, Dog (Biotinylated, MBP, His-Avi)
Cat. No.:
HY-P702846
Quantity:
MCE Japan Authorized Agent: