1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL17
  6. TARC/CCL17 Protein, Dog (HEK293, His)

The TARC/CCL17 protein attracts T lymphocytes, particularly Th2 cells, and is involved in inflammation and immunity. It binds to CCR4 on T cells and contributes to GM-CSF/CSF2-induced pain and inflammation. In the brain, it maintains hippocampal microglia morphology and aids in adapting to neuroinflammation. Additionally, it plays a role in wound healing by promoting fibroblast migration. TARC/CCL17 Protein, Dog (HEK293, His) is the recombinant dog-derived TARC/CCL17 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TARC/CCL17 protein attracts T lymphocytes, particularly Th2 cells, and is involved in inflammation and immunity. It binds to CCR4 on T cells and contributes to GM-CSF/CSF2-induced pain and inflammation. In the brain, it maintains hippocampal microglia morphology and aids in adapting to neuroinflammation. Additionally, it plays a role in wound healing by promoting fibroblast migration. TARC/CCL17 Protein, Dog (HEK293, His) is the recombinant dog-derived TARC/CCL17 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TARC/CCL17 protein serves as a chemokine with specific chemotactic activity for T lymphocytes, particularly Th2 cells, while exhibiting no such attraction for monocytes or granulocytes. Its involvement extends to various inflammatory and immunological processes, facilitated by the binding to CCR4 on the surface of T cells. Additionally, TARC/CCL17 contributes to GM-CSF/CSF2-driven pain and inflammation. In the brain, this chemokine is crucial for maintaining the characteristic, highly branched morphology of hippocampal microglia under homeostatic conditions and may play a pivotal role in adapting microglial morphology and synaptic plasticity during acute lipopolysaccharide (LPS)-induced neuroinflammation. Moreover, TARC/CCL17 plays a significant role in wound healing, primarily by inducing fibroblast migration into the wound.

Biological Activity

Measured by its ability to chemoattract BaF3 mouse pro-B cells transfected with Human CCR4. The ED50 for this effect is 6.096 ng/mL, corresponding to a specific activity is 1.64×10^5 U/mg.

Species

Dog

Source

HEK293

Tag

C-6*His

Accession

Q95N01 (A24-S99)

Gene ID
Molecular Construction
N-term
CCL17 (A24-S99)
Accession # Q95N01
6*His
C-term
Synonyms
rHuTARC/CCL17; C-C motif chemokine 17; SCYA17
AA Sequence

ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES

Molecular Weight

13 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TARC/CCL17 Protein, Dog (HEK293, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TARC/CCL17 Protein, Dog (HEK293, His)
Cat. No.:
HY-P700552
Quantity:
MCE Japan Authorized Agent: