1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL17
  6. TARC/CCL17 Protein, Mouse (His)

The TARC/CCL17 protein selectively attracts T lymphocytes, especially Th2 cells, emphasizing its critical role in inflammation and immunity.TARC/CCL17 binds to CCR4 on the surface of T cells, orchestrates immune responses, and contributes to GM-CSF/CSF2-driven pain and inflammation.TARC/CCL17 Protein, Mouse (His) is the recombinant mouse-derived TARC/CCL17 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TARC/CCL17 protein selectively attracts T lymphocytes, especially Th2 cells, emphasizing its critical role in inflammation and immunity.TARC/CCL17 binds to CCR4 on the surface of T cells, orchestrates immune responses, and contributes to GM-CSF/CSF2-driven pain and inflammation.TARC/CCL17 Protein, Mouse (His) is the recombinant mouse-derived TARC/CCL17 protein, expressed by E.coli , with N-6*His labeled tag.

Background

The TARC/CCL17 protein functions as a chemokine with selective chemotactic activity for T lymphocytes, particularly favoring Th2 cells over monocytes or granulocytes. This specificity underscores its crucial role in various inflammatory and immunological processes. Acting through the binding to CCR4 on the T-cell surface, TARC/CCL17 contributes to orchestrating immune responses. Beyond its immunological functions, it plays a role in GM-CSF/CSF2-driven pain and inflammation. Notably, in the brain, TARC/CCL17 is essential for maintaining the characteristic highly branched morphology of hippocampal microglia under homeostatic conditions and may play a vital role in adapting microglial morphology and synaptic plasticity during acute lipopolysaccharide (LPS)-induced neuroinflammation. Additionally, TARC/CCL17 is implicated in wound healing, primarily by inducing fibroblast migration into the wound. This multifaceted functionality highlights the diverse roles of TARC/CCL17 in both immune responses and tissue repair processes.

Biological Activity

1.Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 of this effect is 3.462 ng/ml, corresponding to a specific activity is 2.89×105 units/mg.
2.Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with human CCR4. The ED50 for this effect is 1.563ng/mL, corresponding to a specific activity is 6.398×10^5 U/mg.

  • Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 of this effect is 3.462 ng/ml, corresponding to a specific activity is 2.89×105 units/mg.
Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q9WUZ6 (A24-P93)

Gene ID
Molecular Construction
N-term
6*His
CCL17 (A24-P93)
Accession # Q9WUZ6
C-term
Synonyms
C-C motif chemokine; CCL17
AA Sequence

ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP

Molecular Weight

Approximately 10 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 or 50 mM Tris-HCL, 200 mM NaCl, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TARC/CCL17 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TARC/CCL17 Protein, Mouse (His)
Cat. No.:
HY-P71891A
Quantity:
MCE Japan Authorized Agent: