Tau-D/0N4R Protein, Human (133a.a, His)

Microtubule-associated protein tau is a microtubule-associated protein found in large numbers in neurons of the central nervous system (CNS). MAPT promotes microtubule assembly and stability and may be involved in the establishment and maintenance of neuronal polarity. Overexpression of MAPT is associated with a poor prognosis of prostate cancer. MAPT has been linked to neurological disorders such as Alzheimer's and Parkinson's disease. Tau-D/0N4R Protein, Human (133a.a, His) is the recombinant human-derived Tau-D/0N4R protein, expressed by E. coli , with C-6*His labeled tag. The total length of Tau-D/0N4R Protein, Human (133a.a, His) is 133 a.a., with molecular weight of ~16.0 kDa.

Microtubule-associated protein tau is a microtubule-associated protein that is found in large quantities in neurons of the central nervous system (CNS). MAPT promotes microtubule assembly and stability and may be involved in the establishment and maintenance of neuronal polarity. MAPT can bind axon microtubules at the C end and neurotic membrane components at the N end, acting as a connexion between the two. Defects in MAPT can lead to neurological diseases such as Alzheimer's and Parkinson's. Overexpression of MAPT is associated with a poor prognosis of prostate cancer. Tau protein S262/S356 can be phosphorylated by AMPK-related kinase^[1][2][3][4].

Human

E. coli

C-6*His

P10636-6 (Q249-Q381)

4137  [NCBI]

QIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQ

Approximately 16.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, 1 mM PMSF, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.