1. Recombinant Proteins
  2. Others
  3. Tau-D/0N4R Protein, Human (133a.a, His)

Tau-D/0N4R Protein, Human (133a.a, His)

Cat. No.: HY-P71102
Data Sheet SDS COA Handling Instructions

Microtubule-associated protein tau is a microtubule-associated protein found in large numbers in neurons of the central nervous system (CNS). MAPT promotes microtubule assembly and stability and may be involved in the establishment and maintenance of neuronal polarity. Overexpression of MAPT is associated with a poor prognosis of prostate cancer. MAPT has been linked to neurological disorders such as Alzheimer's and Parkinson's disease. Tau-D/0N4R Protein, Human (133a.a, His) is the recombinant human-derived Tau-D/0N4R protein, expressed by E. coli , with C-6*His labeled tag. The total length of Tau-D/0N4R Protein, Human (133a.a, His) is 133 a.a., with molecular weight of ~16.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg USD 107 In-stock
50 μg USD 300 In-stock
100 μg   Get quote  

Get it tomorrow December 19 by noon. Order within 8 hrs 30 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Microtubule-associated protein tau is a microtubule-associated protein found in large numbers in neurons of the central nervous system (CNS). MAPT promotes microtubule assembly and stability and may be involved in the establishment and maintenance of neuronal polarity. Overexpression of MAPT is associated with a poor prognosis of prostate cancer. MAPT has been linked to neurological disorders such as Alzheimer's and Parkinson's disease. Tau-D/0N4R Protein, Human (133a.a, His) is the recombinant human-derived Tau-D/0N4R protein, expressed by E. coli , with C-6*His labeled tag. The total length of Tau-D/0N4R Protein, Human (133a.a, His) is 133 a.a., with molecular weight of ~16.0 kDa.

Background

Microtubule-associated protein tau is a microtubule-associated protein that is found in large quantities in neurons of the central nervous system (CNS). MAPT promotes microtubule assembly and stability and may be involved in the establishment and maintenance of neuronal polarity. MAPT can bind axon microtubules at the C end and neurotic membrane components at the N end, acting as a connexion between the two. Defects in MAPT can lead to neurological diseases such as Alzheimer's and Parkinson's. Overexpression of MAPT is associated with a poor prognosis of prostate cancer. Tau protein S262/S356 can be phosphorylated by AMPK-related kinase[1][2][3][4].

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P10636-6 (Q249-Q381)

Gene ID
Molecular Construction
N-term
Tau-D (Q249-Q381)
Accession # P10636-6
6*His
C-term
Synonyms
Microtubule-Associated Protein Tau; Neurofibrillary Tangle Protein; Paired Helical Filament-Tau; PHF-Tau; MAPT; MAPTL; MTBT1; TAU
AA Sequence

QIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQ

Molecular Weight

Approximately 16.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 1 mM PMSF, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

Tau-D/0N4R Protein, Human (133a.a, His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tau-D/0N4R Protein, Human (133a.a, His)
Cat. No.:
HY-P71102
Quantity:
MCE Japan Authorized Agent: