TCblR/CD320 Protein, Mouse (HEK293, His)

TCblR/CD320 Protein, the receptor for cobalamin-saturated transcobalamin (TCbl), plays a pivotal role in cobalamin uptake, expressed on the plasma membrane and notably on follicular dendritic cells (FDC). As a costimulator, TCblR promotes B cell responses, fostering differentiation and proliferation. It's particularly influential in differentiating germinal center-B cells, engaging in collaborative interactions with T-cells and FDC. CD320 enhances IL-10-induced precursor proliferation, underscoring its significance in cobalamin homeostasis and cellular processes through interactions with TCN2. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293, with C-His labeled tag. The total length of TCblR/CD320 Protein, Mouse (HEK293, His) is 208 a.a., with molecular weight of ~47.7 kDa.

TCblR/CD320 Protein, serving as the receptor for transcobalamin saturated with cobalamin (TCbl), assumes a pivotal role in cobalamin uptake. Positioned on the plasma membrane, it is notably expressed on follicular dendritic cells (FDC), facilitating interactions with germinal center B cells. Functioning as a costimulator, TCblR promotes B cell responses to antigenic stimuli, thereby fostering B cell differentiation and proliferation. Particularly influential in the differentiation of germinal center-B (GC-B) cells into memory B-cells and plasma cells (PC), TCblR engages in collaborative interactions with T-cells and follicular dendritic cells (FDC). Its involvement extends to augmenting the proliferation of PC precursors generated by IL-10. The interaction of CD320 with TCN2, mediated through its LDL-receptor class A domains, underscores its significance in cobalamin homeostasis and cellular processes.

Measured by its binding ability in a functional ELISA. Immobilized mouse CD320-His at 10 μg/mL (100 μl/well) can bind biotinylated mouse TCN2-His , The EC₅₀ of biotinylated mouse TCN2-His is 0.10-0.24 μg/mL.

Mouse

HEK293

C-His

Q9Z1P5-1 (M1-G208)

54219  [NCBI]

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Approximately 47.7 kDa

Greater than 90% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.