1. Recombinant Proteins
  2. CD Antigens
  3. Dendritic Cell CD Proteins
  4. 8D6A/CD320
  5. TCblR/CD320 Protein, Mouse (HEK293, His)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs). As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag. The total length of TCblR/CD320 Protein, Mouse (HEK293, His) is 208 a.a., with molecular weight of ~47.7 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) that plays a key role in cobalamin uptake and is expressed on the plasma membrane, especially on follicular dendritic cells (FDCs). As a costimulator, TCblR promotes B cell responses, promoting differentiation and proliferation. TCblR/CD320 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TCblR/CD320 protein, expressed by HEK293 , with C-His labeled tag. The total length of TCblR/CD320 Protein, Mouse (HEK293, His) is 208 a.a., with molecular weight of ~47.7 kDa.

Background

TCblR/CD320 Protein, serving as the receptor for transcobalamin saturated with cobalamin (TCbl), assumes a pivotal role in cobalamin uptake. Positioned on the plasma membrane, it is notably expressed on follicular dendritic cells (FDC), facilitating interactions with germinal center B cells. Functioning as a costimulator, TCblR promotes B cell responses to antigenic stimuli, thereby fostering B cell differentiation and proliferation. Particularly influential in the differentiation of germinal center-B (GC-B) cells into memory B-cells and plasma cells (PC), TCblR engages in collaborative interactions with T-cells and follicular dendritic cells (FDC). Its involvement extends to augmenting the proliferation of PC precursors generated by IL-10. The interaction of CD320 with TCN2, mediated through its LDL-receptor class A domains, underscores its significance in cobalamin homeostasis and cellular processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized mouse CD320-His at 10 μg/mL (100 μl/well) can bind biotinylated mouse TCN2-His , The EC50 of biotinylated mouse TCN2-His is 0.10-0.24 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9Z1P5-1 (M1-G208)

Gene ID
Molecular Construction
N-term
CD320 (M1-G208)
Accession # Q9Z1P5-1
His
C-term
Synonyms
CD320 antigen; 8D6 antigen; FDC-signaling molecule 8D6; FDC-SM-8D6; Transcobalamin receptor; TCblR; CD320
AA Sequence

MARGGAGRAVALGLVLRLLFGLRTGLEAAPAPAHTRVQVSGSRADSCPTDTFQCLTSGYCVPLSWRCDGDQDCSDGSDEEDCRIESCAQNGQCQPQSALPCSCDNISGCSDVSDKNLNCSRPPCQESELHCILDDVCIPHTWRCDGHPDCLDSSDELSCDTDTEIDKIFQEENATTTRISTTMENETSFRNVTFTSAGDSSRNPSAYG

Molecular Weight

Approximately 47.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

TCblR/CD320 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TCblR/CD320 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76798
Quantity:
MCE Japan Authorized Agent: