1. Recombinant Proteins
  2. CD Antigens
  3. Dendritic Cell CD Proteins
  4. 8D6A/CD320
  5. TCblR/CD320 Protein, Rat (HEK293, Fc)

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) and is critical for cobalamin uptake and can influence cell physiology. At the plasma membrane, it is expressed on follicular dendritic cells (FDC), where it helps interact with germinal center B cells and promotes immune responses. TCblR/CD320 Protein, Rat (HEK293, Fc) is the recombinant rat-derived TCblR/CD320 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TCblR/CD320 Protein, Rat (HEK293, Fc) is 182 a.a., with molecular weight of ~47.3 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TCblR/CD320 protein is a receptor for cobalamin-saturated transcobalamin (TCbl) and is critical for cobalamin uptake and can influence cell physiology. At the plasma membrane, it is expressed on follicular dendritic cells (FDC), where it helps interact with germinal center B cells and promotes immune responses. TCblR/CD320 Protein, Rat (HEK293, Fc) is the recombinant rat-derived TCblR/CD320 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TCblR/CD320 Protein, Rat (HEK293, Fc) is 182 a.a., with molecular weight of ~47.3 KDa.

Background

TCblR/CD320 Protein, as the receptor for transcobalamin saturated with cobalamin (TCbl), assumes a crucial role in cobalamin uptake, demonstrating its significance in cellular physiology. Positioned on the plasma membrane, this receptor is notably expressed on follicular dendritic cells (FDC), facilitating interaction with germinal center B cells and contributing to the intricate network of immune responses. Functioning as a costimulator, TCblR promotes B cell responses to antigenic stimuli, thereby fostering B cell differentiation and proliferation. Specifically, it plays a vital role in the differentiation of germinal center-B (GC-B) cells into memory B-cells and plasma cells (PC) through collaborative interactions with T-cells and FDC. Notably, CD320 enhances the proliferation of PC precursors generated by IL-10, showcasing its multifaceted involvement in immune modulation. The interaction of TCblR with TCN2 further highlights its role in cobalamin homeostasis and cellular processes.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Rat CD320 is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant mouse TCN2. The ED50 for this effect is 0.1918 μg/mL.

Species

Rat

Source

HEK293

Tag

C-hFc

Accession

Q5HZW5/NP_001014223.1 (A29-A210)

Gene ID
Molecular Construction
N-term
CD320 (A29-A210)
Accession # Q5HZW5/NP_001014223.1
hFc
C-term
Synonyms
CD320 antigen; 8D6 antigen; FDC-signaling molecule 8D6; FDC-SM-8D6; Transcobalamin receptor
AA Sequence

APAPTSAPAHTLVQVSGPRAGSCPTDTFKCLTSGYCVPLSWRCDGDRDCSDGSDEEECRIEPCAQNRQCQPQPALPCSCDNISGCSAGSDKNLNCSRSPCQEGELRCILDDVCIPHTWRCDGHPDCPDSSDELSCDTDTETDKIFQEENATTSMSSMIVEKETSFRNVTVASAGHPSRNPNA

Molecular Weight

Approximately 65-70 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TCblR/CD320 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TCblR/CD320 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P76226
Quantity:
MCE Japan Authorized Agent: