TDGF1 Protein, Human (GST)

The TDGF1 protein is a GPI-anchored cell membrane protein involved in Nodal signaling. TDGF1 Protein, Human (GST) is the recombinant human-derived TDGF1 protein, expressed by E. coli , with N-GST labeled tag. The total length of TDGF1 Protein, Human (GST) is 119 a.a., with molecular weight of 40.5 kDa.

The TDGF1 Protein, a GPI-anchored cell membrane protein, emerges as a key participant in Nodal signaling. Functioning as a Nodal coreceptor in cis, cell-associated CRIPTO, when shed by TMEM8A, dynamically modulates Nodal signaling by enabling soluble CRIPTO to serve as a Nodal coreceptor on neighboring cells. This shedding mechanism contributes to the intricate regulation of Nodal signaling pathways. Moreover, TDGF1 is implicated in the determination of epiblastic cells, which subsequently give rise to the mesoderm, underlining its significance in early developmental processes. Notably, TDGF1 interacts with the activin type-1 receptor ACVR1B, further underscoring its role in mediating critical cellular signaling events.

Human

E. coli

N-GST

P13385 (G32-D150)

6997  [NCBI]

GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD

40.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.