TDGF1 Protein, Mouse (HEK293, His)

TDGF1, a GPI-anchored protein, participates in Nodal signaling pathways as a coreceptor in cis. Shedding by Tmem8a dynamically regulates Nodal signaling, releasing soluble TDGF1. This shedding mechanism modulates the Nodal pathway and suggests a role in determining the fate of epiblastic cells, particularly in mesoderm formation. TDGF1 also interacts with ACVR1B, emphasizing its importance in cellular responses. TDGF1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TDGF1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TDGF1 Protein, Mouse (HEK293, His) is 125 a.a., with molecular weight of ~19-23 kDa.

TDGF1, a glycosylphosphatidylinositol (GPI)-anchored cell membrane protein, actively participates in Nodal signaling pathways. Functioning as a Nodal coreceptor, TDGF1 operates in cis, and its cell-associated form acts synergistically with the signaling molecule. Notably, shedding of TDGF1 by Tmem8a dynamically regulates Nodal signaling by releasing soluble TDGF1, enabling it to serve as a Nodal coreceptor on neighboring cells. This shedding mechanism introduces a level of modulation to the Nodal pathway. TDGF1's involvement in these signaling cascades suggests a potential role in determining the fate of epiblastic cells, particularly those contributing to the formation of the mesoderm. Additionally, TDGF1 interacts with the activin type-1 receptor ACVR1B, further highlighting its significance in mediating crucial cellular responses.

Mouse

HEK293

C-6*His

P51865 (R26-Q150)

21667

RDLAIRDNSIWDQKEPAVRDRSFQFVPSVGIQNSKSLNKTCCLNGGTCILGSFCACPPSFYGRNCEHDVRKEHCGSILHGTWLPKKCSLCRCWHGQLHCLPQTFLPGCDGHVMDQDLKASGTPCQ

Approximately 19-23 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU/μg, determined by LAL method.