1. Recombinant Proteins
  2. Others
  3. Tetranectin/CLEC3B Protein, Mouse (HEK293, His)

Tetranectin/CLEC3B Protein, Mouse (HEK293, His)

Cat. No.: HY-P76671
Handling Instructions Technical Support

Tetranectin/CLEC3B protein exhibits binding to plasminogen and isolated kringle 4, suggesting potential roles in exocytosis-related molecule packaging and ocular physiology.Its homotrimeric structure emphasizes a propensity for trimeric complexes, highlighting the multifaceted nature of Tetranectin/CLEC3B in diverse molecular interactions and cellular processes.Tetranectin/CLEC3B Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tetranectin/CLEC3B protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Tetranectin/CLEC3B protein exhibits binding to plasminogen and isolated kringle 4, suggesting potential roles in exocytosis-related molecule packaging and ocular physiology.Its homotrimeric structure emphasizes a propensity for trimeric complexes, highlighting the multifaceted nature of Tetranectin/CLEC3B in diverse molecular interactions and cellular processes.Tetranectin/CLEC3B Protein, Mouse (HEK293, His) is the recombinant mouse-derived Tetranectin/CLEC3B protein, expressed by HEK293 , with C-His labeled tag.

Background

The Tetranectin/CLEC3B protein demonstrates binding capabilities to plasminogen and isolated kringle 4. It is implicated in potential roles related to the packaging of molecules designated for exocytosis, suggesting a function in cellular secretion processes. Additionally, Tetranectin/CLEC3B plays a role in retinal function, indicating its involvement in ocular physiology. Structurally, it forms homotrimers, emphasizing its tendency to exist as trimeric complexes. The diverse binding capacities and proposed functions underscore the multifaceted nature of Tetranectin/CLEC3B, implicating its involvement in various molecular interactions and cellular processes.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human HGF is coated at 5 μg/mL (100 μL/well) can bind Recombinant Mouse CLEC3B. The ED50 for this effect is 4.025 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P43025 (E22-V202)

Gene ID
Molecular Construction
N-term
CLEC3B (E22-V202)
Accession # P43025
His
C-term
Synonyms
TN; C-Type Lectin Domain Family 3 Member B; Plasminogen Kringle 4-Binding Protein; TNA
AA Sequence

ESPTPKAKKAANAKKDLVSSKMFEELKNRMDVLAQEVALLKEKQALQTVCLKGTKVNLKCLLAFTQPKTFHEASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDMTGGLLAYKNWETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQFAIV

Molecular Weight

Approximately 22-25 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Tetranectin/CLEC3B Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tetranectin/CLEC3B Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76671
Quantity:
MCE Japan Authorized Agent: