TFF1 Protein, Human

TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human is the recombinant human-derived TFF1 protein, expressed by E. coli , with tag free. The total length of TFF1 Protein, Human is 60 a.a..

Trefoil Factor 1 (TFF1) protein acts as a stabilizer for the mucous gel that overlays the gastrointestinal mucosa, playing a crucial role in providing a robust physical barrier against a variety of noxious agents. By contributing to the integrity of the mucous layer, TFF1 aids in the protection and defense of the gastrointestinal tract from potential harmful substances. Its stabilizing function underscores its importance in maintaining the mucosal barrier, which is essential for the overall health and protection of the gastrointestinal mucosa.

Measured by its ability to induce ERK1/ERK2 phosphorylation in Jurkat human acute T cell leukemia cells. 10μg/mL of Recombinant Human TFF1 can effectively induce ERK1/2 phosphorylation.

Human

E. coli

Tag Free

P04155 (E25-F84)

7031  [NCBI]

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Approximately 12 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.