TFF3 Protein, Canine (HEK293, His)

TFF3 Protein intricately maintains and repairs the intestinal mucosa, acting as a motogen that promotes epithelial cell mobility during healing. Existing as a monomer, TFF3 can form homodimers through disulfide linkages, suggesting a role in mediating crucial interactions. Its involvement in mucosal repair underscores TFF3's significance in dynamic processes that preserve the integrity and functionality of the intestinal lining. TFF3 Protein, Canine (HEK293, His) is the recombinant canine-derived TFF3 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of TFF3 Protein, Canine (HEK293, His) is 57 a.a., with molecular weight of 9.2 kDa.

The TFF3 Protein is intricately involved in the maintenance and repair of the intestinal mucosa, playing a pivotal role in promoting the mobility of epithelial cells during healing processes, acting as a motogen. The protein exists as a monomer and can form homodimers through disulfide linkages. This dimeric structure underscores its potential role in mediating interactions crucial for its functional activities. TFF3's participation in mucosal repair highlights its significance in contributing to the dynamic processes that maintain the integrity and functionality of the intestinal lining.

Canine

HEK293

C-10*His

Q863B4 (Y24-F80)

403488  [NCBI]

YQGLATNLCEVPPKDRVDCGYPEITSEQCVNRGCCFDSSIHGVPWCFKPLQDTECRF

9.2 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.