TFF3 Protein, Human (P. pastoris, His)

TFF3 Protein is crucial for maintaining and repairing the intestinal mucosa, promoting epithelial cell mobility as a motogen. As a monomer, TFF3 has individual effects, while as a disulfide-linked homodimer, it enhances cellular responses for intestinal lining integrity. TFF3's multifaceted nature underscores its significance in balancing mucosal maintenance and repair in the gastrointestinal tract. TFF3 Protein, Human (P. pastoris, His) is the recombinant human-derived TFF3 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of TFF3 Protein, Human (P. pastoris, His) is 52 a.a., with molecular weight of 7.5 kDa.

TFF3 Protein plays a pivotal role in the maintenance and repair of the intestinal mucosa, actively participating in healing processes by promoting the mobility of epithelial cells as a motogen. Existing both as a monomer and a homodimer, the disulfide-linked homodimeric form suggests a potential collaborative enhancement of its functions. While functioning as a monomer, TFF3 likely exerts individual effects, and as a homodimer, it may synergistically contribute to the dynamic cellular responses crucial for the integrity and restoration of the intestinal lining. The multifaceted nature of TFF3 underscores its significance in orchestrating the intricate balance of mucosal maintenance and repair within the gastrointestinal tract.

Human

P. pastoris

N-6*His

Q07654 (L29-V80)

7033  [NCBI]

LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV

7.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.