1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TFF3 Protein, Mouse (HEK293, His)

TFF3 Protein maintains and repairs the intestinal mucosa, promoting epithelial cell mobility as a motogen.TFF3's monomer form has functional properties, while its homodimeric form enhances cellular responses for intestinal lining integrity.TFF3's involvement in mucosal homeostasis and repair highlights its significance in gastrointestinal tract dynamics.TFF3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFF3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFF3 Protein maintains and repairs the intestinal mucosa, promoting epithelial cell mobility as a motogen.TFF3's monomer form has functional properties, while its homodimeric form enhances cellular responses for intestinal lining integrity.TFF3's involvement in mucosal homeostasis and repair highlights its significance in gastrointestinal tract dynamics.TFF3 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFF3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TFF3 Protein plays a vital role in the maintenance and repair of the intestinal mucosa, actively contributing to the healing processes by promoting the mobility of epithelial cells, acting as a motogen. As a monomer, TFF3 exhibits individual functional properties, while its homodimeric form, connected by disulfide bonds, likely enhances its capabilities in facilitating cellular responses crucial for the integrity and restoration of the intestinal lining. The involvement of TFF3 in these processes underscores its significance in the dynamic mechanisms of mucosal homeostasis and repair within the gastrointestinal tract.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q62395 (A23-F81)

Gene ID
Molecular Construction
N-term
TFF3 (A23-F81)
Accession # Q62395
6*His
C-term
Synonyms
Trefoil factor 3; Intestinal trefoil factor; mITF; Tff3; Itf
AA Sequence

ADYVGLSPSQCMVPANVRVDCGYPSVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF

Molecular Weight

Approximately 11.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

TFF3 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFF3 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P71356
Quantity:
MCE Japan Authorized Agent: