TFIIF-associating CTD phosphatase Protein, Mouse (Myc, His)

The TFIIF-related CTD phosphatase protein plays a key role in promoting RNA polymerase II activity by dephosphorylating "Ser-2" and "Ser-5" residues. This enhances the function of RNA polymerase II, allowing the protein to participate in the transcription process. TFIIF-associating CTD phosphatase Protein, Mouse (Myc, His) is the recombinant mouse-derived TFIIF-associating CTD phosphatase protein, expressed by E. coli , with N-His, C-Myc labeled tag.

The TFIIF-associating CTD phosphatase appears to have a critical role in promoting the activity of RNA polymerase II by processively dephosphorylating 'Ser-2' and 'Ser-5' residues within the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit. This enzymatic activity enhances the functionality of RNA polymerase II, suggesting its involvement in transcriptional processes. Additionally, the protein contributes to the exit from mitosis by dephosphorylating key mitotic substrates, including USP44, CDC20, and WEE1, which are essential for the inactivation of M-phase-promoting factor (MPF)/CDK1. This dual role underscores the regulatory significance of the TFIIF-associating CTD phosphatase in coordinating both transcriptional and cell cycle processes.

Mouse

E. coli

N-His;C-Myc

Q7TSG2-1 (H178-R341)

67655  [NCBI]

HRNRKLVLMVDLDQTLIHTTEQHCPQMSNKGIFHFQLGRGEPMLHTRLRPHCKDFLEKIAKLYELHVFTFGSRLYAHTIAGFLDPEKKLFSHRILSRDECIDPFSKTGNLRNLFPCGDSMVCIIDDREDVWKFAPNLITVKKYVYFPGTGDVNAPPAARETQAR

Approximately 24.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.