TFPI Protein, Rabbit (HEK293, His)

TFPI Protein inhibits factor X (Xa) directly and, in an Xa-dependent manner, hinders the activity of VIIa/tissue factor, possibly by forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. This multifunctional protein has antithrombotic properties and associates with lipoproteins in plasma, highlighting its crucial role in regulating the coagulation pathway. TFPI Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived TFPI protein, expressed by HEK293 , with N-10*His labeled tag. The total length of TFPI Protein, Rabbit (HEK293, His) is 276 a.a., with molecular weight of 55 kDa.

TFPI (Tissue Factor Pathway Inhibitor) exerts direct inhibition on factor X (Xa) and, in an Xa-dependent manner, hinders the activity of VIIa/tissue factor, potentially through the formation of a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. This multifunctional protein showcases antithrombotic properties and demonstrates an affinity for association with lipoproteins in plasma, highlighting its pivotal role in regulating the intricate dynamics of the coagulation pathway.

Measured by its binding ability in a functional ELISA. Immobilized TFPI, Rabbit (HEK293, His) at 1 μg/mL can bind Anti-TFPI recombinant antibody, the EC₅₀ is ≤6 ng/mL.

Rabbit

HEK293

N-10*His

P19761 (A25-T300)

100009401  [NCBI]

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.