1. Recombinant Proteins
  2. Others
  3. TFPI Protein, Rabbit (HEK293, His)

TFPI Protein inhibits factor X (Xa) directly and, in an Xa-dependent manner, hinders the activity of VIIa/tissue factor, possibly by forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. This multifunctional protein has antithrombotic properties and associates with lipoproteins in plasma, highlighting its crucial role in regulating the coagulation pathway. TFPI Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived TFPI protein, expressed by HEK293 , with N-10*His labeled tag. The total length of TFPI Protein, Rabbit (HEK293, His) is 276 a.a., with molecular weight of 55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFPI Protein inhibits factor X (Xa) directly and, in an Xa-dependent manner, hinders the activity of VIIa/tissue factor, possibly by forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. This multifunctional protein has antithrombotic properties and associates with lipoproteins in plasma, highlighting its crucial role in regulating the coagulation pathway. TFPI Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived TFPI protein, expressed by HEK293 , with N-10*His labeled tag. The total length of TFPI Protein, Rabbit (HEK293, His) is 276 a.a., with molecular weight of 55 kDa.

Background

TFPI (Tissue Factor Pathway Inhibitor) exerts direct inhibition on factor X (Xa) and, in an Xa-dependent manner, hinders the activity of VIIa/tissue factor, potentially through the formation of a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. This multifunctional protein showcases antithrombotic properties and demonstrates an affinity for association with lipoproteins in plasma, highlighting its pivotal role in regulating the intricate dynamics of the coagulation pathway.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized TFPI, Rabbit (HEK293, His) at 1 μg/mL can bind Anti-TFPI recombinant antibody, the EC50 is ≤6 ng/mL.

Species

Rabbit

Source

HEK293

Tag

N-10*His

Accession

P19761 (A25-T300)

Gene ID
Molecular Construction
N-term
10*His
TFPI (A25-T300)
Accession # P19761
C-term
Synonyms
TFPI; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor); LACI; tissue factor pathway inhibitor; EPI; extrinsic pathway inhibitor; TFI; TFPI1; anti-convertin;
AA Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Molecular Weight

55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TFPI Protein, Rabbit (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFPI Protein, Rabbit (HEK293, His)
Cat. No.:
HY-P700431
Quantity:
MCE Japan Authorized Agent: