1. Recombinant Proteins
  2. Others
  3. TFPI2 Protein, Human (HEK293, C-His)

TFPI2 Protein, Human (HEK293, C-His)

Cat. No.: HY-P71358A
SDS COA Handling Instructions

The critical role of the TFPI2 protein in regulating plasmin-mediated matrix remodeling suggests its involvement in extracellular matrix dynamics. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weak factor Xa, affecting coagulation and fibrinolysis. TFPI2 Protein, Human (HEK293, C-His) is the recombinant human-derived TFPI2 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE TFPI2 Protein, Human (HEK293, C-His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The critical role of the TFPI2 protein in regulating plasmin-mediated matrix remodeling suggests its involvement in extracellular matrix dynamics. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weak factor Xa, affecting coagulation and fibrinolysis. TFPI2 Protein, Human (HEK293, C-His) is the recombinant human-derived TFPI2 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

The TFPI2 protein may have a crucial role in the regulation of plasmin-mediated matrix remodeling, suggesting its involvement in the intricate processes that govern extracellular matrix dynamics. TFPI2 exhibits inhibitory effects on trypsin, plasmin, factor VIIa/tissue factor, and weakly on factor Xa, indicating its potential influence on various proteolytic activities involved in coagulation and fibrinolysis. Notably, TFPI2 does not affect thrombin. It is found in a complex with ABCB1, TFPI2, and PPP2R3C, leading to the dephosphorylation of ABCB1. This complex formation hints at potential regulatory mechanisms involving TFPI2 in modulating the phosphorylation state of ABCB1, which could have broader implications for cellular processes. Further exploration into the specific mechanisms and downstream effects of TFPI2's inhibitory functions and its interactions within the ABCB1-containing complex could provide valuable insights into its multifaceted role in the regulation of hemostasis and matrix remodeling.

Biological Activity

Measured by its ability to inhibit proliferation of A549 human lung carcinoma cells. The ED50 this effect is 43.15 ng/mL, corresponding to a specific activity is 2.32×104 units/mg.

Species

Human

Source

HEK293

Tag

C-10*His

Accession

P48307 (D23-K213)

Gene ID
Molecular Construction
N-term
TFPI2 (D23-K213)
Accession # P48307
10*His
C-term
Synonyms
Tissue Factor Pathway Inhibitor 2; TFPI-2; Placental Protein 5; PP5; TFPI2
AA Sequence

DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALK

Molecular Weight

Approximately 18-32 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TFPI2 Protein, Human (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFPI2 Protein, Human (HEK293, C-His)
Cat. No.:
HY-P71358A
Quantity:
MCE Japan Authorized Agent: