TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293)

TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293), is a recombinant cytokine produced in HEK293 cells, is implicated as a key regulator of the development and cyclic remodelling characteristic of reproductive tissues^[1][2].

TGFB1 (transforming growth factor beta 1) is a potent cytokine playing a driving role in development, fibrosis and cancer. It is synthesized as prodomain-growth factor complex that requires tethering to LTBP (latent transforming growth factor beta binding protein) for efficient secretion into the extracellular space. Upon release, this large latent complex is sequestered by anchorage to extracellular matrix (ECM) networks, from which the mature growth factor needs to be activated in order to reach its receptors and initiate signaling^[2].

The ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells has an ED50 value of 5-25 pg/mL.

Rat; Mouse

HEK293

Tag Free

P04202(A279-S390)

21803  [NCBI]

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Approximately 13.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Ingman WV, et al. The essential roles of TGFB1 in reproduction. Cytokine Growth Factor Rev. 2009;20(3):233-239.  [Content Brief]

  [2]. Nüchel J, et al. TGFB1 is secreted through an unconventional pathway dependent on the autophagic machinery and cytoskeletal regulators. Autophagy. 2018;14(3):465-486.  [Content Brief]