TGF beta 1/TGFB1 Protein, Xenopus laevis (P. pastoris, His)

TGFB1 proprotein is the precursor of latency-associated peptide (LAP) and active transforming growth factor Beta-1 (TGF-β-1) chain, which maintains TGF-β-1 latency in the extracellular matrix. Through non-covalent binding, TGFB1 critically regulates TGF-β-1 activation by interacting with “environmental molecules” (LTBP1, LRRC32/GARP, LRRC33/NRROS) that collectively control TGF-β-1 activation. TGF beta 1/TGFB1 Protein, Xenopus laevis (P. pastoris, His) is the recombinant Xenopus laevis-derived TGF beta 1/TGFB1 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of TGF beta 1/TGFB1 Protein, Xenopus laevis (P. pastoris, His) is 112 a.a., with molecular weight of 14.6 kDa.

The Transforming Growth Factor Beta-1 (TGFB1) proprotein serves as the precursor for both the Latency-associated peptide (LAP) and the active Transforming Growth Factor Beta-1 (TGF-beta-1) chains, constituting the regulatory and active subunit of TGF-beta-1, respectively. It plays a crucial role in maintaining the TGF-beta-1 chain in a latent state during storage within the extracellular matrix. Through a non-covalent association with TGF-beta-1, TGFB1 regulates its activation by interacting with 'milieu molecules' such as LTBP1, LRRC32/GARP, and LRRC33/NRROS, which collectively control the activation of TGF-beta-1. Furthermore, the interaction of TGFB1 with integrins (ITGAV:ITGB6 or ITGAV:ITGB8) induces the distortion of the Latency-associated peptide chain, leading to the subsequent release of active TGF-beta-1.

Xenopus laevis

P. pastoris

N-6*His

P16176 (G271-S382)

397778  [NCBI]

GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS

14.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.