TGFBR2/TGF-beta RII Protein, Human (HEK293, Fc)

TGF-beta receptor 2 Protein, Human (HEK293, Fc), a fragment of transforming growth factor-beta receptor type 2 (TβRII), consists of amino acid of Thr23-Asp159 with an Fc tag at the C-terminus.

Transforming growth factor-beta receptor type 2 (TβRII) is a 567 amino acid single-pass type I membrane protein that contains one protein kinase domain. TβRII is the specific receptor for TGFβ ligands, and crucial for the regulation of TGFβ signaling in tumor initiation, progression, and metastasis^[1]. T beta R-II (transforming growth factor beta [TGF-beta] type II receptor) is a transmembrane serine/threonine kinase that acts as the primary TGF-beta receptor. Ligand binding to T beta R-II leads to the recruitment and phosphorylation of T beta R-I, a distantly related transmembrane kinase that acts as a downstream signaling component^[2].

Measured by its ability to inhibit TGF-beta 1 activity on HT-2 mouse T cells. The ED₅₀ this effect is 3.527 μg/mL in the presence of 0.25 ng/mL of recombinant human TGF-beta 1, corresponding to a specific activity is 283.527 units/mg.

• 
  Measured by its ability to inhibit TGF-beta 1 activity on HT-2 mouse T cells. The ED₅₀ for this effect is 3.527 μg/mL in the presence of 0.25 ng/mL of recombinant human TGF-beta 1, corresponding to a specific activity is 283.527 units/mg.

Human

HEK293

C-hFc

P37173 (T23-D159)

7048  [NCBI]

TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD

Approximately 55-75 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Gao N, et al. Clinical Implications of TβRII Expression in Breast Cancer. PLoS One. 2015 Nov 9;10(11):e0141412.  [Content Brief]

  [2]. Cárcamo J, et al. Disruption of transforming growth factor beta signaling by a mutation that preventstransphosphorylation within the receptor complex. Mol Cell Biol. 1995 Mar;15(3):1573-81.  [Content Brief]