TGFBR2/TGF-beta RII Protein, Rhesus Macaque (HEK293, Fc)

TGFBR2/TGF-beta RII Protein collaborates with TGFBR1 to form a dedicated receptor for TGFB1, TGFB2, and TGFB3. It serves as a signal transducer, orchestrating diverse physiological and pathological processes, including cell cycle regulation, mesenchymal cell dynamics, wound healing, matrix production, immunosuppression, and carcinogenesis. Upon cytokine binding, the receptor complex activates TGFBR1 through TGFBR2 phosphorylation, initiating the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR2 participates in non-canonical, SMAD-independent pathways. TGFBR2/TGF-beta RII Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived TGFBR2/TGF-beta RII protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TGFBR2/TGF-beta RII Protein, Rhesus Macaque (HEK293, Fc) is 136 a.a., with molecular weight of ~50-70 KDa.

TGFBR2 (TGF-β RII), collaborates with the TGF-beta type I serine/threonine kinase receptor, TGFBR1, to form the dedicated receptor for TGF-beta cytokines, including TGFB1, TGFB2, and TGFB3. Functioning as a signal transducer, TGFBR2 mediates the transmission of TGFB1, TGFB2, and TGFB3 signals from the cell surface to the cytoplasm, thereby orchestrating a diverse array of physiological and pathological processes. These include cell cycle arrest in epithelial and hematopoietic cells, regulation of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression, and carcinogenesis. The receptor complex, comprising 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer, leads to the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 subsequently phosphorylates SMAD2, causing its dissociation from the receptor and interaction with SMAD4. The resulting SMAD2-SMAD4 complex translocates to the nucleus, where it modulates the transcription of TGF-beta-regulated genes, constituting the canonical SMAD-dependent TGF-beta signaling cascade. Additionally, TGFBR2 participates in non-canonical, SMAD-independent TGF-beta signaling pathways and exhibits transforming growth factor beta-activated receptor activity^[1][2].

Immobilized Rhesus TGFB1-His at 10 μg/mL (100 μL/well) can bind Rhesus TGFBR2. The ED₅₀ for this effect is 25.22 ng/mL.

Rhesus Macaque

HEK293

C-hFc

NP_001248080.1 (I24-D159)

703088  [NCBI]

IPPHVQKSVNNDMMVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCLSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD

Approximately 50-70 kDa.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.