Thioredoxin/TXN Protein, E.coli (His)

Thioredoxin/TXN Protein, E.coli (His) is a hydrogen carrier protein and exists widely in organism. Thioredoxin suppression disbalances insulin responsiveness in chicken cardiomyocytes through PI3K/Akt pathway inhibition^[1][2].

Thioredoxin (Txn) is a hydrogen carrier protein and exists widely in organism. Txn deficiency implicates cardiomyocytes injury has been proven. Thioredoxin (Txn) system is the most crucial antioxidant defense mechanism in cell consisting of Txn, thioredoxin reductase (TR) and Nicotinamide Adenine Dinucleotide Phosphate (NADPH). Txn system can redox regulate the insulin dependent glucose metabolism in heart and is essential for cell vitality^[1][2].

Its ability to catalyze the reduction of insuline by precipitation reaction measured by absorbance at 650 nm. The specific activity is 3 units/mg, as measured under the described conditions.

E.coli

E. coli

C-His

M26133 (M1-A109)

948289  [NCBI]

MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

Approximately 13 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filter solution of 50 mM Tris-HCl, 0.15 M NaCl, 1 mM EDTA, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Yang J, et, al. Dysfunction of thioredoxin triggers inflammation through activation of autophagy in chicken cardiomyocytes. Biofactors. 2020 Jul;46(4):579-590.  [Content Brief]

  [2]. Yang J, et, al. Selenium deficiency-induced thioredoxin suppression and thioredoxin knock down disbalanced insulin responsiveness in chicken cardiomyocytes through PI3K/Akt pathway inhibition. Cell Signal. 2017 Oct;38:192-200.  [Content Brief]