Thioredoxin/TXN Protein, Human

Thioredoxin/TXN Protein participates in diverse redox reactions, using its active center dithiol for reversible oxidation and disulfide bond formation. It catalyzes crucial dithiol-disulfide exchanges and plays a pivotal role in S-nitrosylation of cysteine residues, responding to intracellular nitric oxide. Thioredoxin regulates caspase-3 activity by nitrosylating CASP3's active site cysteine. It also influences FOS/JUN AP-1 DNA binding and augments interleukin-2 receptor expression, showcasing its multifaceted cellular role beyond redox regulation. Thioredoxin/TXN Protein, Human is the recombinant human-derived Thioredoxin/TXN protein, expressed by E. coli, with tag free. The total length of Thioredoxin/TXN Protein, Human is 105 a.a., with molecular weight of ~14 kDa.

Thioredoxin/TXN Protein actively engages in diverse redox reactions, employing the reversible oxidation of its active center dithiol to form a disulfide bond, and catalyzes crucial dithiol-disulfide exchange reactions. Beyond its classical redox functions, Thioredoxin plays a pivotal role in the reversible S-nitrosylation of cysteine residues within target proteins, contributing to the cellular response to intracellular nitric oxide. Notably, it exerts regulatory control over caspase-3 activity by nitrosylating the active site cysteine of CASP3 in response to nitric oxide. Moreover, Thioredoxin demonstrates its influence on the FOS/JUN AP-1 DNA-binding activity in ionizing radiation cells, modulating AP-1 transcriptional activity through its oxidation/reduction status. Additionally, Thioredoxin is implicated in the augmentation of interleukin-2 receptor TAC (IL2R/P55) expression, highlighting its multifaceted role in cellular processes beyond redox regulation.

Measured by its ability to catalyze the reduction of insulin. The reaction leads toprecipitation, which can be measured by absorbance at 650 nm and the specific activity is 5-10 A650/min/mg.

Human

E. coli

Tag Free

P10599 (M1-V105)

7295

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Approximately 14 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.