1. Recombinant Proteins
  2. Receptor Proteins
  3. Thrombin Receptor/PAR1 Protein, Human (HEK293, His)

Thrombin Receptor/PAR1 Protein, Human (HEK293, His)

Cat. No.: HY-P73612
SDS COA Handling Instructions Technical Support

The thrombin receptor/PAR1 protein is a high-affinity receptor for activated thrombin that is coupled to G proteins to stimulate phosphoinositide hydrolysis. This signaling mechanism suggests its involvement in platelet activation, which is critical for hemostasis and thrombosis. Thrombin Receptor/PAR1 Protein, Human (HEK293, His) is the recombinant human-derived Thrombin Receptor/PAR1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The thrombin receptor/PAR1 protein is a high-affinity receptor for activated thrombin that is coupled to G proteins to stimulate phosphoinositide hydrolysis. This signaling mechanism suggests its involvement in platelet activation, which is critical for hemostasis and thrombosis. Thrombin Receptor/PAR1 Protein, Human (HEK293, His) is the recombinant human-derived Thrombin Receptor/PAR1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Thrombin Receptor/PAR1 Protein serves as a high-affinity receptor for activated thrombin, forming a coupling with G proteins that, in turn, stimulate phosphoinositide hydrolysis. This intricate signaling mechanism suggests its potential involvement in platelet activation, a critical process in hemostasis and thrombosis. Furthermore, Thrombin Receptor/PAR1 Protein may play a role in vascular development, indicating its significance in the complex regulatory pathways that govern blood vessel formation and maintenance. The dual functions of this receptor highlight its role in both hemostatic processes and broader aspects of vascular biology, underscoring its importance in maintaining cardiovascular homeostasis.

Species

Human

Source

HEK293

Tag

C-His

Accession

P25116/NP_001983.2 (A22-T102)

Gene ID
Molecular Construction
N-term
PAR1 (A22-T102)
Accession # P25116/NP_001983.2
His
C-term
Synonyms
Cf2r; CF2RHTR; F2R; HTR; PAR1; Protease-Activated Receptor 1
AA Sequence

ARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT

Molecular Weight

Approximately 22-37 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Thrombin Receptor/PAR1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thrombin Receptor/PAR1 Protein, Human (HEK293, His)
Cat. No.:
HY-P73612
Quantity:
MCE Japan Authorized Agent: