Thrombin Receptor/PAR1 Protein, Human (HEK293, His)

The thrombin receptor/PAR1 protein is a high-affinity receptor for activated thrombin that is coupled to G proteins to stimulate phosphoinositide hydrolysis. This signaling mechanism suggests its involvement in platelet activation, which is critical for hemostasis and thrombosis. Thrombin Receptor/PAR1 Protein, Human (HEK293, His) is the recombinant human-derived Thrombin Receptor/PAR1 protein, expressed by HEK293 , with C-His labeled tag.

Thrombin Receptor/PAR1 Protein serves as a high-affinity receptor for activated thrombin, forming a coupling with G proteins that, in turn, stimulate phosphoinositide hydrolysis. This intricate signaling mechanism suggests its potential involvement in platelet activation, a critical process in hemostasis and thrombosis. Furthermore, Thrombin Receptor/PAR1 Protein may play a role in vascular development, indicating its significance in the complex regulatory pathways that govern blood vessel formation and maintenance. The dual functions of this receptor highlight its role in both hemostatic processes and broader aspects of vascular biology, underscoring its importance in maintaining cardiovascular homeostasis.

Human

HEK293

C-His

P25116/NP_001983.2 (A22-T102)

2149  [NCBI]

ARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT

Approximately 22-37 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.