1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins
  4. BDCA-3/CD141
  5. Thrombopoietin Protein, Cynomolgus (HEK293, His)

Thrombopoietin Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P76672
COA Handling Instructions

TPO/Thrombopoietin Protein is a major regulator of megakaryocyte production and platelet generation, signaling through its receptor Mpl to stimulate the proliferation of megakaryocyte progenitor cells and induce megakaryocyte maturation. Thrombopoietin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Thrombopoietin protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $75 In-stock
50 μg $215 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TPO/Thrombopoietin Protein is a major regulator of megakaryocyte production and platelet generation, signaling through its receptor Mpl to stimulate the proliferation of megakaryocyte progenitor cells and induce megakaryocyte maturation. Thrombopoietin Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Thrombopoietin protein, expressed by HEK293 , with C-His labeled tag.

Background

TPO/Thrombopoietin Protein is a major regulatory factor for megakaryocyte production, which signals through its receptor Mpl to stimulate the proliferation of megakaryocyte progenitor cells and induce megakaryocyte maturation. In addition, TPO/Thrombopoietin Protein can induce receptor dimerization and tyrosine phosphorylation, as well as activate signaling pathways, such as JAK/STAT, Shc/Ras/MAPK, and PI3K/Akt[1].
In adult hematopoietic processes, TPO/Thrombopoietin Protein maintains the resting state of hematopoietic stem cells (HSC). And the loss of TPO/Thrombopoietin Protein signaling is associated with bone marrow failure and thrombocytopenia[2].

Biological Activity

Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 14.13 ng/mL, corresponding to a specific activity is 7.077×104 units/mg.

  • Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 14.13 ng/mL, corresponding to a specific activity is 7.077×104 units/mg.
Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

XP_005546625.1(S22-G353)

Gene ID
Molecular Construction
N-term
Thrombopoietin (S22-G353)
Accession # XP_005546625.1
His
C-term
Synonyms
Thrombopoietin; C-mpl ligand; THPO; MGDF
AA Sequence

SPAPPACDPRVLSKLLRDSRVLHSRLSLCPEVNPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLLLVGGPTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLQKRQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHKLLNGTRGLFPGPSRRTLGAPDISPGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPSPVVQLHPLLPDPSAPTPTPTSPLLNTSHTHSQNLSQEG

Molecular Weight

Approximately 70-96 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thrombopoietin Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P76672
Quantity:
MCE Japan Authorized Agent: