Thrombospondin-2 Protein, Mouse (His)

Thrombospondin-2 protein, also known as CD36 ligand, mediates anti-angiogenic properties. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration. Thrombospondin-2 Protein, Mouse (His) is the recombinant mouse-derived Thrombospondin-2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Thrombospondin-2 Protein, Mouse (His) is 214 a.a., with molecular weight of ~30 kDa.

Thrombospondin-2 protein is a disulfide-linked homotrimeric adhesion glycoprotein belonging to the thrombospondin family. Thrombospondin-2 is a CD36 ligand with anti-angiogenic properties that mediates cell-cell and cell-matrix interactions. Thrombospondin-2 may regulate cell surface properties of mesenchymal cells and be involved in cell adhesion and migration.

Mouse

E. coli

N-6*His

Q03350 (G19-A232)

21826

GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA

Approximately 30 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.