1. Recombinant Proteins
  2. Others
  3. THSD1 Protein, Human (HEK293, His)

THSD1 Protein, Human (HEK293, His)

Cat. No.: HY-P71360
SDS COA Handling Instructions

THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of THSD1 Protein, Human (HEK293, His) is 337 a.a., with molecular weight of 60-90 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

THSD1 Protein positively regulates nascent focal adhesion assembly, influencing endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, interacting specifically with TLN1. THSD1 Protein, Human (HEK293, His) is the recombinant human-derived THSD1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of THSD1 Protein, Human (HEK293, His) is 337 a.a., with molecular weight of 60-90 kDa.

Background

THSD1 protein functions as a positive regulator in the assembly of nascent focal adhesions, contributing to the modulation of endothelial cell attachment to the extracellular matrix. It forms a complex with PTK2/FAK1, TLN1, and VCL, emphasizing its involvement in crucial cellular processes related to focal adhesion dynamics. THSD1's interaction with TLN1 underscores its role in coordinating molecular events essential for the proper formation and function of focal adhesions, which play a pivotal role in cellular adhesion and signaling.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9NS62-2 (E25-I361)

Gene ID
Molecular Construction
N-term
THSD1 (E25-I361)
Accession # Q9NS62-2
6*His
C-term
Synonyms
Thrombospondin Type-1 Domain-Containing Protein 1; Transmembrane Molecule with Thrombospondin Module; THSD1; TMTSP
AA Sequence

EYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQTVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKAAEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPRYPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTAFQPSSPSPLQPQGPVKSNNI

Molecular Weight

60-90 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

THSD1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
THSD1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71360
Quantity:
MCE Japan Authorized Agent: