1. Recombinant Proteins
  2. CD Antigens
  3. Macrophage CD Proteins Stem Cell CD Proteins Endothelial cell CD Proteins
  4. Thy-1/CD90
  5. Thy1/CD90 Protein, Rat (HEK293, His)

The Thy1/CD90 protein may play a role in key cellular processes associated with neurodevelopment, particularly during synaptogenesis and other brain events, suggesting its involvement in cell-cell or cell-ligand interactions. Thy1/CD90 Protein, Rat (HEK293, His) is the recombinant rat-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag. The total length of Thy1/CD90 Protein, Rat (HEK293, His) is 110 a.a., with molecular weight of ~23-27 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Thy1/CD90 protein may play a role in key cellular processes associated with neurodevelopment, particularly during synaptogenesis and other brain events, suggesting its involvement in cell-cell or cell-ligand interactions. Thy1/CD90 Protein, Rat (HEK293, His) is the recombinant rat-derived Thy1/CD90 protein, expressed by HEK293 , with C-His labeled tag. The total length of Thy1/CD90 Protein, Rat (HEK293, His) is 110 a.a., with molecular weight of ~23-27 kDa.

Background

The Thy1/CD90 protein is suggested to potentially play a role in cell-cell or cell-ligand interactions, particularly during synaptogenesis and other events in the brain, indicating its involvement in critical processes related to neural development and synaptic connectivity. The precise mechanisms and specific contexts in which Thy1/CD90 operates during these events remain areas of interest, underscoring its potential significance in orchestrating cellular interactions in the intricate landscape of the brain. The versatility of Thy1/CD90 in mediating cell communication and potentially influencing synaptic formation emphasizes the need for further exploration to elucidate its exact functions and molecular mechanisms in these dynamic processes.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Rat CD90 is immobilized at 5.00 µg/mL (100 µL/well) can bind Human Galectin-1. The ED50 for this effect is 0.3630 μg/mL.

Species

Rat

Source

HEK293

Tag

C-His

Accession

P01830 (Q20-K129)

Gene ID
Molecular Construction
N-term
Thy1 (Q20-K129)
Accession # P01830
His
C-term
Synonyms
Thy-1 membrane glycoprotein; CDw90; Thy-1 antigen; CD90
AA Sequence

QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVK

Molecular Weight

Approximately 23-27 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thy1/CD90 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74514
Quantity:
MCE Japan Authorized Agent: