Thymopoietin Protein, Human (His)

Thymopoietin protein critically directs nuclear lamina assembly and maintains structural organization in the nuclear envelope. It is considered a potential receptor that attaches lamina fibrils to the inner nuclear membrane, where it anchors key structural components. Thymopoietin Protein, Human (His) is the recombinant human-derived Thymopoietin protein, expressed by E. coli , with C-6*His labeled tag. The total length of Thymopoietin Protein, Human (His) is 187 a.a., with molecular weight of ~23.0 kDa.

Thymopoietin (TP) emerges as a protein that may play a pivotal role in directing the assembly of the nuclear lamina, contributing to the maintenance of structural organization within the nuclear envelope. It is postulated to be a potential receptor for attaching lamin filaments to the inner nuclear membrane, suggesting its involvement in anchoring crucial structural components. Furthermore, TP may participate in the control of DNA replication initiation through interaction with NAKAP95, implicating its regulatory function in cellular processes. Beyond its structural and regulatory roles, both Thymopoietin (TP) and its derivative Thymopentin (TP5) are associated with potential functions in T-cell development and function, with TP5 specifically noted as an immunomodulating pentapeptide, highlighting the multifaceted contributions of Thymopoietin to cellular and immune processes.

Human

E. coli

C-6*His

P42167 (M1-E187)

7112  [NCBI]

PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE

Approximately 23.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.