1. Recombinant Proteins
  2. Others
  3. Thymopoietin Protein, Human (His)

Thymopoietin protein critically directs nuclear lamina assembly and maintains structural organization in the nuclear envelope. It is considered a potential receptor that attaches lamina fibrils to the inner nuclear membrane, where it anchors key structural components. Thymopoietin Protein, Human (His) is the recombinant human-derived Thymopoietin protein, expressed by E. coli , with C-6*His labeled tag. The total length of Thymopoietin Protein, Human (His) is 187 a.a., with molecular weight of ~23.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Thymopoietin protein critically directs nuclear lamina assembly and maintains structural organization in the nuclear envelope. It is considered a potential receptor that attaches lamina fibrils to the inner nuclear membrane, where it anchors key structural components. Thymopoietin Protein, Human (His) is the recombinant human-derived Thymopoietin protein, expressed by E. coli , with C-6*His labeled tag. The total length of Thymopoietin Protein, Human (His) is 187 a.a., with molecular weight of ~23.0 kDa.

Background

Thymopoietin (TP) emerges as a protein that may play a pivotal role in directing the assembly of the nuclear lamina, contributing to the maintenance of structural organization within the nuclear envelope. It is postulated to be a potential receptor for attaching lamin filaments to the inner nuclear membrane, suggesting its involvement in anchoring crucial structural components. Furthermore, TP may participate in the control of DNA replication initiation through interaction with NAKAP95, implicating its regulatory function in cellular processes. Beyond its structural and regulatory roles, both Thymopoietin (TP) and its derivative Thymopentin (TP5) are associated with potential functions in T-cell development and function, with TP5 specifically noted as an immunomodulating pentapeptide, highlighting the multifaceted contributions of Thymopoietin to cellular and immune processes.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P42167 (M1-E187)

Gene ID
Molecular Construction
N-term
Thymopoietin (M1-E187)
Accession # P42167
6*His
C-term
Synonyms
Lamina-Associated Polypeptide 2 Isoforms Beta/Gamma; Thymopoietin Isoforms Beta/Gamma; TP Beta/Gamma; Thymopoietin-Related Peptide Isoforms Beta/Gamma; TPRP Isoforms Beta/Gamma; Thymopoietin; TP; Splenin; Thymopentin; TP5; TMPO; LAP2
AA Sequence

PEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNE

Molecular Weight

Approximately 23.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Thymopoietin Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Thymopoietin Protein, Human (His)
Cat. No.:
HY-P71361
Quantity:
MCE Japan Authorized Agent: