Thymosin beta 4 Protein, Human

TMSB4X proteins play a critical role in cytoskeletal organization, influencing actin dynamics by binding and sequestering actin monomers. As a potent inhibitor of actin polymerization, it affects the cytoskeleton. Thymosin beta 4 Protein, Human is the recombinant human-derived Thymosin beta 4 protein, expressed by E. coli , with tag free. The total length of Thymosin beta 4 Protein, Human is 43 a.a., with molecular weight of ~4.9 kDa.

TMSB4X protein assumes a crucial role in cytoskeletal organization, as evidenced by its documented impact on actin dynamics. It functions by binding to and sequestering actin monomers (G actin), thereby acting as a potent inhibitor of actin polymerization. Beyond its influence on the cytoskeleton, TMSB4X emerges as a robust inhibitor of bone marrow-derived stem cell differentiation, exerting its effects by impeding the entry of hematopoietic pluripotent stem cells into the S-phase. These multifaceted functions underscore the significance of TMSB4X in orchestrating fundamental cellular processes, including cytoskeletal integrity and stem cell differentiation, highlighting its regulatory role in maintaining cellular homeostasis and orchestrating dynamic cellular responses.

1.The biological activity determined by its ability to produce a protective effect against hydrogen peroxide in primary lung fibroblasts is in a concentration range of 0.5 - 10 μg/mL.
2.Measured in inhibiting cell proliferation assay using A549 cells. The ED₅₀ for this effect is 1.824 μg/mL.

Human

E. coli

Tag Free

P62328 (S2-S44)

7114  [NCBI]

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Approximately 12 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, pH 7.4 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg; determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.