TIGIT Protein, Cynomolgus (HEK293, C-hFc)

Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions, therefore being involved in biological processes such as down-regulation of T cell activation or cardiac and neuronal development. TIGIT Protein, Cynomolgus (HEK293, C-hFc) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag.

Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions. Some member of Ig-like domain-containing protein can bind to membrane Ig signaling receptors and down-regulating T cell activation through competing with Ig proteins for binding, and Ig-like domain-containing protein such as neuregulin proteins can bind to heparin through IgL-like domain, contributing to cardiac and neuronal development^[1][2].

Cynomolgus

HEK293

C-hFc

G7NXM4 (M89-P209)

102121588

MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP

45-55 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.