1. Recombinant Proteins
  2. Immune Checkpoint Proteins
  3. Inhibitory Checkpoint Molecules
  4. TIGIT Protein
  5. TIGIT Protein, Cynomolgus (HEK293, C-hFc)

Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions, therefore being involved in biological processes such as down-regulation of T cell activation or cardiac and neuronal development. TIGIT Protein, Cynomolgus (HEK293, C-hFc) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TIGIT Protein, Cynomolgus (HEK293, C-hFc) is 121 a.a., with molecular weight of 45-55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions, therefore being involved in biological processes such as down-regulation of T cell activation or cardiac and neuronal development. TIGIT Protein, Cynomolgus (HEK293, C-hFc) is the recombinant cynomolgus-derived TIGIT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TIGIT Protein, Cynomolgus (HEK293, C-hFc) is 121 a.a., with molecular weight of 45-55 kDa.

Background

Ig-like domain-containing protein is a class of proteins that may be involved in protein–protein and protein–ligand interactions. Some member of Ig-like domain-containing protein can bind to membrane Ig signaling receptors and down-regulating T cell activation through competing with Ig proteins for binding, and Ig-like domain-containing protein such as neuregulin proteins can bind to heparin through IgL-like domain, contributing to cardiac and neuronal development[1][2].

Species

Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

G7NXM4 (M89-P209)

Gene ID

102121588

Molecular Construction
N-term
TIGIT (M89-P209)
Accession # G7NXM4
hFc
C-term
Synonyms
T-cell immunoreceptor with Ig and ITIM domains; VSIG9; VSTM3; TIGIT; V-set and transmembrane domain-containing protein 3; V-set and immunoglobulin domain-containing protein 9
AA Sequence

MMTGTIETTGNISAKKGGSVILQCHLSSTMAQVTQVNWEQHDHSLLAIRNAELGWHIYPAFKDRVAPGPGLGLTLQSLTMNDTGEYFCTYHTYPDGTYRGRIFLEVLESSVAEHSARFQIP

Molecular Weight

45-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TIGIT Protein, Cynomolgus (HEK293, C-hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TIGIT Protein, Cynomolgus (HEK293, C-hFc)
Cat. No.:
HY-P71007
Quantity:
MCE Japan Authorized Agent: