TIM-3/HAVCR2 Protein, Marmoset (HEK293, His)

TIM-3/HAVCR2 Protein is a transmembrane glycoprotein of the TIM family of immune regulating molecules and plays an important role in the Th1-mediated immune response^[1]. TIM-3/HAVCR2 Protein, Marmoset (HEK293, His) is the recombinant Marmoset-derived TIM-3/HAVCR2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TIM-3/HAVCR2 Protein, Marmoset (HEK293, His) is 170 a.a., with molecular weight of 30-45 kDa.

TIM-3/HAVCR2 Protein is a transmembrane protein of T lymphocytes (CD4⁺ and CD8⁺ T cells), other lymphocytes (like NK cells), myeloid cells (monocytes, macrophages, DC, mast cells), or various cells in different tumor types. TIM-3/HAVCR2 Protein is an immune checkpoint and together with other inhibitory receptors including programmed cell death protein 1 (PD-1) and lymphocyte activation gene 3 protein (LAG3) mediate the CD8+ T-cell exhaustion in terms of proliferation and secretion of cytokines such as TNF-alpha, IFN-gamma and IL-2^[2][3].TIM-3/HAVCR2 Protein has also been shown as a CD4+ Th1-specific cell surface protein that regulates macrophage activation, regulates the production of cytokines and enhances the severity of experimental autoimmune encephalomyelitis in mice^[1].

Marmoset

HEK293

C-6*His

F7I881 (E21-I190)

100399869  [NCBI]

EEYIVEVGQNAYLPCFYTLDTPGNLVPVCWGKGACPVFECGDVVLRTDERDVSYRTSSRYWLNGDFHKGNVTLAIGNVTLEDSGIYCCRVQIPGIMNDKKFNLKLVIKPAKVTPAPTLPRDSTPAFPRMLTTEDHGPAETQTLEILHDKNLTQLSTLANELQDAGTTIRI

30-45 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.